KEGG   Yersinia pestis Pestoides F: YPDSF_1394Help
Entry
YPDSF_1394        CDS       T00505                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YPDSF_1394
  Lipid metabolism
   00561 Glycerolipid metabolism
    YPDSF_1394
   00600 Sphingolipid metabolism
    YPDSF_1394
Enzymes [BR:ypp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     YPDSF_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1560457..1562583
Genome map
AA seq 708 aa AA seqDB search
MNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEALNRPVANSRLDSDIPLTL
CPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTIISEDTSAGLRLVSELQMCP
DSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNGRWIKEFQRHSLKLDHGGY
IQENRRGRTSHEYFPGMVVGKAGFSEQQGEVWGLHLALSGNHRLRADCKSDGRRQVQAEA
LYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQNIVPSLAEKPRPVHLNTW
EGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLSSLGDWYIDAEKYPQGLNP
IIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYPLLKGRDQLLLDLSNPAVF
DYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQTEQLYRLFDQLNLHFPHIE
FESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSYFFPPEVMGAHIGGTPCHT
TARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIALHKQLRPLLHSGNTIRLDH
PDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLNPSTHYQIEVLDMPDSMHK
PRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILIQLSAVN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaatactacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctct
ccctacgcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatg
gaagccttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctc
tgccctgaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggc
gaagattggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacg
attattagcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgccca
gacagtggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccga
atcgatcggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttc
aatggccgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttat
attcaggaaaatcggcgcggcagaacctcacatgaatattttcccggcatggtagtaggg
aaagcaggcttcagtgagcaacagggcgaggtctggggcttgcatctggccttgagtgga
aaccatcgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagcc
ctctatttttccggtgaaatcgttctggaacacttgcaaagtgtcagtaccccgtgggtc
tacgcgacctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtg
cgccagaatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacttgg
gaaggcatctattttaagcatgacccagactacattattcagatggtgaaaaacgcggcc
aaaattggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgat
ttaagttcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaacccc
attattgaagcagtgaatgaatacggtatggagtttggtatctgggtggaacctgaaatg
atcaatcaggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggc
tacccgctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttc
gactacctgctagaacgcttgagctggttgttgggcgaacacaaagttgactatgttaaa
tgggatttcaaccgcgagatggtccagcccggtcaccgcggccacccttcgttggtacaa
cagaccgagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaa
tttgaatcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccac
cgtttctggccatcagacagcaacgacgctcttgatcgccagcaaattcagcgagggatg
agctacttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccatacc
accgccagaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggg
gtcgagcttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatatt
gcgctacataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccat
ccggataaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtc
ctgatcagccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggt
cttaacccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaa
ccacgaaataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagt
ggcgattggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatc
ctgatacagctttcagccgtaaattaa

DBGET integrated database retrieval system