KEGG   Yersinia pestis Pestoides F: YPDSF_1436Help
Entry
YPDSF_1436        CDS       T00505                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPDSF_1436
   00052 Galactose metabolism
    YPDSF_1436
   00500 Starch and sucrose metabolism
    YPDSF_1436
   00520 Amino sugar and nucleotide sugar metabolism
    YPDSF_1436
Enzymes [BR:ypp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YPDSF_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1610409..1611302)
Genome map
AA seq 297 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYVVNECVAAGINEIILITHSSK
NAVENHFDTSYELEAMLEARVKRQLLDEVQSICPPGVTIMHIRQGHPEGVGHAVLCAKPL
VGDSPFVVLLPDVLIDDEQSDLTRDNLAQLVQRFEETGVSQVLVHSVDPETLSNYSVVSC
EKSTLLPGESSRINAMIEKPQSSADLQSNLSAVGRYVLSAHIWPLLEQTKPGAWGRIQLT
DAIDALAAVEAVDAVALTGKSYNCGEKLGYMQAYVAYGLRHPQQGAEFKAWLKDFVA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgaaagcagtcatccctgtcgctggtttaggcatgagaatgctcccggcg
accaaagctattccgaaagagatgttgccaatcgttgataagccacttatccagtatgtg
gtgaacgaatgtgttgctgcgggcatcaacgaaattattctgataacccattcatccaag
aacgccgtagaaaaccattttgatacttcctatgaattggaagcgatgctggaggcccgt
gttaagcgccagctattggatgaagtgcagtcaatttgcccaccgggtgtgacaataatg
catattcgtcaggggcatccagagggggtgggccacgctgttttatgcgccaaaccgtta
gtgggtgattcgccatttgttgtcttgctgccagatgttctaattgatgatgagcaatct
gatttaacccgcgataatctggctcaattagtgcaacgttttgaagagaccggggtcagc
caagttttggttcattcggtagatcctgaaacgctgtctaattattcggtggtttcctgt
gagaaatcgaccttgttgccaggggagagcagccggattaatgccatgatcgagaagcca
caaagttcggcagatttacaatcaaatctgtctgcggtggggcgctatgtactgtcagcg
catatttggccattgttggaacagacgaaacccggcgcttgggggcgtatccaactgacc
gatgctattgatgctttggctgcggtagaggcggttgatgcggttgccttaaccggtaag
tcctataactgcggtgagaaactcggctatatgcaggcttatgtggcttatggtttgcgt
cacccacagcaaggggctgaatttaaggcatggctaaaggatttcgtcgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system