KEGG   Yersinia pestis Pestoides F: YPDSF_1769Help
Entry
YPDSF_1769        CDS       T00505                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ypp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ypp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1993417..1994406)
Genome map
AA seq 329 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAQDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAYS
ELIADKIRTAAKARLPQRVLENKPAMLSHTPLLSSEKLIAIGASTGGTEAIRAVLQPLPP
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHLELARSG
ANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGAY
TLAQNEASCVVFGMPREAIAMGGLMTSWS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtattgtgtgttgatgattctgcattaatgcgtcagctaatgact
gagattattaacagtcacccggatatggagatggttgctgcggcacaggatccgttggtt
gcccgtgatttgatcaaaaaatttaatccacaagttttgacgcttgacgtggaaatgcct
cgcatggatggcttggattttctcgagaaattgatgcgtctacggcccatgccggtggtg
atggtgtcttccctaacgggtaaaaactccgaaataaccatgcgggcgttggagttgggg
gcgattgattttgtcaccaaacctcagttagggatccgcgaaggaatgctggcttacagc
gaactgattgccgataagatccgcacggcggctaaggctcgtttaccacagcgcgtcctg
gaaaataaaccggcgatgctcagccataccccattgctcagcagtgaaaaattgatcgcc
attggggcatcaactggcggtactgaggcgattcgtgcggtattacagcctttgccacca
accagtccggcattgctgatcactcagcatatgccgccgggatttacccgttcgtttgct
gaacgcttgaataaactgtgccaaatcacggtaaaagaagcagaggatggcgagcgagta
ttaccgggacatgcctatattgcacccggtgatcggcacttggaactggcccggagtggt
gccaactaccaggtgcggatccatgatggacccgcggttaatcgtcaccgtccttcggtt
gacgttcttttccgttcggtggcgcagtatgccgggcgcaatgcggtcggggtgatcctc
acggggatgggcaatgatggagccgctggcttgctggagatgcaccgggcgggtgcctac
accctcgcgcaaaatgaggccagctgcgtggtctttggtatgccacgtgaggcgattgcg
atgggggggttaatgacgtcgtggagttga

DBGET integrated database retrieval system