KEGG   Yersinia pestis Pestoides F: YPDSF_2562Help
Entry
YPDSF_2562        CDS       T00505                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
ypp00010  Glycolysis / Gluconeogenesis
ypp00052  Galactose metabolism
ypp01100  Metabolic pathways
ypp01110  Biosynthesis of secondary metabolites
ypp01120  Microbial metabolism in diverse environments
ypp01130  Biosynthesis of antibiotics
Module
ypp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPDSF_2562
   00052 Galactose metabolism
    YPDSF_2562
Enzymes [BR:ypp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     YPDSF_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABP40932
JGI: YPDSF2562
Position
2910648..2911544
Genome map
AA seq 298 aa AA seqDB search
MLLGYPTPADYLHQAAYLGATVGRYANRIANAQITLDGETIQLVPNQGPNQLHGGPEGFH
AQRWQKVTQDDHQVTYKLDSPDGDQGFPGNLTVEVQYLLTEDNRLEIHYQAQVDKTCPVN
LTNHAYFNLDGEGHDARSHRLQLFADRYLPVDSAGIPTGGLADVENTGMDFRQPKTLAQD
FLQDRCQQRVKGYDHAYLLHRTCGALDSPAAHLWSSDNQVQMSMFTSAPALQLYSGNYLA
GTPARNGGTYASYAGVALESEFLPDSPNHPEWPQPDCWLKPGKTYRSTTVYHFIALPL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgctactgggctacccgacaccggctgattacctgcatcaagccgcttatctcggggcc
acggttggccgttatgccaaccggatagccaatgcgcaaatcaccttggatggcgaaaca
atccagttggtcccgaaccaaggccctaaccaattacacggtggcccggaaggtttccat
gcccagcgttggcagaaagtgacccaagatgaccaccaggttacctataaacttgattca
ccagatggcgatcaaggtttccccggtaatctgactgttgaagtacagtacctgctaacc
gaagataaccggctggaaattcattatcaggcacaggtggataaaacctgcccggttaac
ctgaccaatcatgcctatttcaaccttgacggcgaagggcatgatgcccgttcacatcgt
ttgcaactgtttgcagaccgttacctgcctgtcgacagtgcgggcatcccaaccggagga
ctcgctgatgtcgagaataccggtatggattttcgccaacctaaaacattggcgcaggat
tttctacaagatcgctgccagcaacgagttaaaggctatgaccacgcttatttgctgcac
cgcacctgtggggccttagactctccggcggcacacttgtggtcatccgataaccaggtg
caaatgagtatgttcacctcagcgcctgcgttgcagctttacagcggaaattatcttgct
ggcacacccgcacgcaacggcggcacctatgccagctatgcgggtgtggcactagaaagt
gaatttttgcctgatagccctaaccaccctgaatggccacagcccgattgttggctaaaa
ccggggaagacctatcgctcaacgacggtttatcactttattgcgttgcctttataa

DBGET integrated database retrieval system