KEGG   Yersinia pestis Pestoides F: YPDSF_2652Help
Entry
YPDSF_2652        CDS       T00505                                 

Definition
D-alanyl-D-alanine carboxypeptidase fraction A (EC:3.4.16.4)
Orthology
K07258  
D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ypp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3005697..3006899
Genome map
AA seq 400 aa AA seqDB search
MKYVITSRIIKSLALGTVIVMSAANADDVNLKTMIPGVPQIDAEAYILIDYNSGKVLAEM
NADTRRNPASLTKMMTSYVIGQAIKSGKIGAEDMVTVGKDAWATGNPEFKGSSLMFLKPG
DRVPVSKLTRGINLQSGNDACVAMADYVAGSQDSFVNLMNNYVKALGLQNTHFKTVHGLD
AEGQFSSARDMALIGQALIRDVPDEYAIYKEKEFTFNNIRQTNRNGLLWDTSLNVDGIKT
GHTEAAGYNLVASATDGQMRLISVVLGGHTFKGRETESKKLLTWGFRFFETVAPLKVGKE
FASEPVWFGDSDRVQLGVDKDAYLTIPRGRMKDLKASYVLNTPEIHAPLAKNQVVGTINF
QLDGKTIDQRPLVVMNEVKEGGFFSRMVDYIKLMFHRWFG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaattacctctcgcattatcaagagcctagcgctcggcactgttattgtc
atgagcgctgctaacgctgatgacgtcaatctgaaaaccatgatccccggcgtaccgcag
atcgacgcagaagcctacatcctaattgattacaactccgggaaagtattggcggaaatg
aacgcggatacgcgccgcaacccagccagtttgaccaaaatgatgaccagctacgtcatc
ggccaggcgattaaatcagggaaaatcggggctgaagacatggtcaccgtgggtaaagat
gcctgggctaccggtaacccggaatttaaaggctcctccctgatgtttctgaaaccgggc
gaccgtgtgccggtgtctaaactgacccgtggtatcaacttacaatcgggtaacgatgcc
tgcgtcgcgatggccgattatgtcgcggggagtcaggactcattcgttaacctgatgaac
aactatgttaaggcgctgggcttacaaaatacccacttcaaaactgttcacggtttagat
gcggaaggccagttcagctctgcacgcgatatggcattgattggtcaagccctgatccgt
gatgtgccagatgagtatgctatctataaagagaaagagtttaccttcaacaatatccgc
cagacaaaccgtaacggtttactgtgggacaccagtttgaacgtagatggcatcaaaacc
ggtcacaccgaggcagcaggttataatctggtcgcatcagcgactgatggacagatgcgt
ttgatttcagtcgttttaggcggccatacctttaagggccgtgaaactgaaagtaaaaaa
ctgctgacctgggggttccgtttctttgaaaccgtcgcaccgctgaaagtcggtaaagag
tttgcctcagaaccggtctggtttggcgatagtgatcgtgtgcagttaggtgtagataaa
gatgcttatctgactattccacgtggccgaatgaaagacctgaaagccagctatgtgctg
aatacacctgaaattcatgcgccactggcgaaaaaccaagttgtgggaaccattaacttc
cagttagatggtaaaaccatcgatcagcgcccattggtggtgatgaacgaagtaaaagaa
ggtggtttcttcagccgtatggtggattatatcaagctgatgttccaccgctggtttggc
taa

DBGET integrated database retrieval system