KEGG   Yersinia pestis Pestoides F: YPDSF_2718Help
Entry
YPDSF_2718        CDS       T00505                                 

Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPDSF_2718
Enzymes [BR:ypp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPDSF_2718
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPDSF_2718
Lipid biosynthesis proteins [BR:ypp01004]
 Fatty acid synthase
  Component type
   YPDSF_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3084725..3085363
Genome map
AA seq 212 aa AA seqDB search
MMNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQA
TPSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSE
IINQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEW
MQDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggatta
ttcagtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgcc
ggttaccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagcc
acgccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaaggg
ctagcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactg
ggcgccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaa
attatcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccc
cctaactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaa
cagttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtgg
atgcaggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatg
gcgcaacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system