KEGG   Yersinia pestis Pestoides F: YPDSF_2968Help
Entry
YPDSF_2968        CDS       T00505                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YPDSF_2968
Enzymes [BR:ypp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     YPDSF_2968
Amino acid related enzymes [BR:ypp01007]
 Aminotransferase (transaminase)
  Class III
   YPDSF_2968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3371103..3372383)
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWG
PMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATM
SAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCT
YNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSG
NPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFT
NADTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAAR
RCFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatccgaaaatctgtatgcccaagcacaacagttgatcccgggcggggttaac
tctccggtgcgtgcattcacaggtgttgggggcatcccactctttattgaacgtgctgat
ggtgcttacctctttgacgtagatggcaaagcctatattgactatgtcggctcttggggg
ccaatgatcttgggccataatcaccctgctattcgtcaggcggtcattgaggccgttgaa
cgtggcctaagttttggtgcaccgacagagatggaagtgaaaatggctcagttggttaca
gatttggtgccaaccatggatatggtacggatggtcaattccggcaccgaagccaccatg
agtgccatccgtctggcccgaggctataccggtcgcgataagataattaaattcgaaggc
tgctatcacggccatgccgattgtttgttggtaaaagcaggctcaggcgcactgacactg
ggtcagcccaattcacctggtgttcctacggattttgccaaacacaccctgacctgtacc
tataacgatctggcttctgtacggcaggcctttgagcaatatccgcaagaagtggcgtgt
attatcgttgagccagtagccggtaatatgaattgcattcccccgttgccagagttcctg
cctggtctgcgcgctttgtgtgatgagtttggtgctctgcttatcatcgatgaagtcatg
accggttttcgcgtagccttagctggcgcgcaggattattaccatgtcatccctgattta
acctgtctgggtaaaatcattggtggcggtatgccagtaggcgcttttggtggccgccgt
gaggtaatgaatgcgctggcaccgactggcccggtttaccaagccggtacgctatccggt
aaccctatcgctatggctgccggttttgcctgcctgacagaaatctctcaggtcggtgtt
tatgaaacactgaccgaattaaccgactcactggctacaggcctgcgacatgccgctaaa
gaggagaacatcccactggtggttaaccacgtcggtgggatgtttggcctattctttacc
aatgctgataccgtcacctgctatcaggatgtgatgaattgtgatgttgagcgctttaaa
cgtttcttccatttgatgctggaagaaggggtctatctggcaccgtcagcctttgaagcg
ggctttatgtctctggctcacagcaacgaagatattcagaaaaccgtcaatgccgctcgt
cgatgctttgctaaactttaa

DBGET integrated database retrieval system