KEGG   Yersinia pestis Pestoides F: YPDSF_3003Help
Entry
YPDSF_3003        CDS       T00505                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ypp  Yersinia pestis Pestoides F
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3407753..3408379
Genome map
AA seq 208 aa AA seqDB search
MVNKRMQTLLMQLRQQGIHDERLLQAIEAVPRERFVDEALAHKAYENTALPIGAGQTISQ
PYMVARMTELLQLTPTSRVLEIGTGSGYQTAILAHLVDHVCSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWLGWQSRGPFDAIIVTAAPPEIPDALLEQLDEGGILVLPVGEQFQTLK
YVQRRNNEYHIETVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataaacgcatgcaaacattgttgatgcagttacgtcagcaaggtattcacgat
gaacgcctgttacaggcgatcgaagcggtaccgcgtgagcgttttgtcgatgaagcgttg
gctcataaggcttatgagaataccgctctccctataggtgcggggcaaacgatttctcag
ccttatatggtggcgcgaatgacagagttactgcaattgacgccaacgtccagagtctta
gagatcggaacggggtcaggctaccagacggctattttggcgcatctggtcgatcatgtc
tgttcagtcgagcgaatcaaagggttacagtggcaggcaaaacgtcgcctaaaacagttg
gatctgcataatgtgtcgacccgccatggtgatggttggttgggctggcagtctcgtggg
ccgtttgatgccattattgtaaccgcagcaccgcctgaaattccggatgcattacttgag
caattggatgaagggggaatactggttcttcccgttggtgagcagttccaaacattaaag
tacgtgcaacgccgtaacaatgaataccatattgagacggtggaagccgtccgttttgtt
cctctggttaaaggggaacttgcctaa

DBGET integrated database retrieval system