KEGG   Yersinia pestis Pestoides F: YPDSF_3337Help
Entry
YPDSF_3337        CDS       T00505                                 

Definition
metalloprotease (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
ypp  Yersinia pestis Pestoides F
Brite
Enzymes [BR:ypp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     YPDSF_3337
Peptidases [BR:ypp01002]
 Metallo Peptidases
  Family M10
   YPDSF_3337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3819848..3821176
Genome map
AA seq 442 aa AA seqDB search
MSYSREYSNTIIKNEQVMRRGIHYKNEVKGVIAPQISSRQSWKENTIHNKNTNLTYSFSR
AYTLWDYDRTFQQNAYISLFNPAQIHQAKIAMQSWADVANISFTEASADSSANILFLNFQ
RPSNVAGYAYYPNPGSFSPIWINYSFSDNQHPSRLNDGGGVLTHEIGHALGLGHSHAPHG
YTQQMSVMSYLSEQGSGANYGQHYLSTPQMYDIAAIQYLYGANLHTRTGDTVYGFNSTSY
RDHFTATHASDALIFCVWDAGGNDTFDFSGYKQNQMINLNELCFSDVGGLKGNVSIAADV
TIENAIGGSGHDDIIGNHTNNILTGNGGSDQLWGNGGNNTFRYASARDSMTTSPDTIHDF
KSGRDKIDLSQLMPSTDRVIFVDRLSFNGQTEMGQQYNEVADITYLMIDFDAQVSECDMM
IKFTGRHHFTANDFILSTSLTA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagttactccagggaatacagcaatactataattaaaaatgaacaggtcatgcgtaga
ggcattcattataagaatgaagttaaaggtgttatagcaccacaaatatctagccgtcag
tcatggaaagaaaacaccattcataataaaaatacaaacctgacatattcatttagtcga
gcctatacattatgggattatgatcgaacattccaacagaacgcttacatctcattattt
aatccagcccaaatccatcaggcaaaaatcgcgatgcaatcttgggctgatgtagccaac
atctccttcaccgaagcatcagcagactcctccgccaatattctatttttaaattttcag
cgcccaagtaatgtggcaggttatgcctattatcctaatccaggtagcttcagcccaata
tggattaattacagtttcagcgataaccaacatcccagcagattaaatgatggtggcgga
gtattaacacatgagatcggccatgctctggggttgggtcattctcatgccccccatggc
tatacacagcaaatgagtgtaatgagctatttatccgaacagggttcaggtgcaaattat
ggccaacattacttatccacaccacaaatgtacgatatcgccgcaatccagtatctgtat
ggggccaatctacacacccgcaccggtgataccgtttatggcttcaactcgacgagttat
agagatcatttcaccgccacccacgccagtgatgcgttgattttctgtgtctgggatgct
ggcggcaatgatacttttgacttctctggctataagcaaaatcaaatgattaatcttaac
gaactctgtttttctgatgttggtggactaaaaggaaatgtgtctattgcagcggatgtt
acgattgaaaatgccatcggcggcagtggccatgatgatattatcggcaatcacaccaat
aatattttgaccggtaacggcggatctgatcaactttggggtaacgggggcaataatact
ttccgctatgccagtgccagagattcaatgaccacctcgcccgatactattcatgatttt
aaatcaggccgtgacaagatagatttgtcgcaattaatgccctcaaccgaccgtgttatt
tttgtcgatagattaagttttaacggtcaaacagagatggggcagcaatataatgaagtg
gcggacataacttatcttatgattgattttgacgctcaagtcagcgagtgcgatatgatg
attaaatttaccggcaggcaccatttcaccgccaatgactttattttaagtacgtcactg
acggcataa

DBGET integrated database retrieval system