KEGG   Yersinia pestis Pestoides F: YPDSF_3468Help
Entry
YPDSF_3468        CDS       T00505                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YPDSF_3468 (hemD)
Enzymes [BR:ypp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     YPDSF_3468 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3976633..3977382
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPELLQDMQAGDLVFALS
QNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVTFPPMGETSEMLLSLPL
LQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPIYYDGSEQSAHWQRAGVD
ILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALATQMGWTEVRVAENADNDA
LIRALQDLQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcctggtcacccgtccatcccctgctggggagcaattagtcactcgcctgcgt
gctctgggccgggttgcctaccatgcgccattgattgatttttccccaggaagagacctg
cccaaactgccggaattattgcaagatatgcaagcgggagacttggtttttgctttatca
cagaacgcggtccgctacgctaacccgctgttaaaaagaaataaactgtcatggcctgtg
cagttatcttattatgctattggccgtacaaccgcattagcactgcataccgccagccgt
ttgcatgtcactttcccaccaatgggggagaccagtgaaatgctgctatcattgcccctg
ctgcaaaatttggccggtaaaaaggcactgttattacgcggtaatgggggccgggagttg
ctaggcgcaagcctcgcagaacgcggagcggccgtgaccttctgcgaatgctatcaacgc
agtcccatctattatgatggcagcgaacaaagtgctcactggcaacgtgccggtgttgat
attctggtggtcaccagcggcgaaatgttacaacagatctatactttagttcctgattac
tatcgttcttcctggttactgcgttgccgtttaatcgttgtgagtgatcgtttagcggcc
ttagccacccaaatggggtggacggaggtccgggtagcagaaaatgccgataatgacgca
ctgatccgtgcgttacaagaccttcaataa

DBGET integrated database retrieval system