KEGG   Yersinia pestis Pestoides F: YPDSF_3813Help
Entry
YPDSF_3813        CDS       T00505                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ypp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4381821..4383344
Genome map
AA seq 507 aa AA seqDB search
MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIYPKAGWVEHDPMEIWA
TQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVYNAIVWQCRRTADICEK
LKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAERGELLFGTVDTWLVWNMT
QGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPEVRPSSEIYGKTNIGGKGG
TRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGEEAVQSTHGLLTTIACGP
RGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFATKVKNSNGVYVVPAFTGLGAP
YWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGARLKSLRVDGGAVA
NNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATGFWDDLDEVKSKASIEREFRPGI
ETTERDIRYKGWKKAVARARDWEEHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatactactcaaaaaaaatacattgtcgcacttgatcaggggacaacc
agctccagggcggtagtactggatcacaatgcaaatatcgtgagtgtttctcagcgtgaa
ttcactcagatttacccaaaggctggctgggttgagcatgacccaatggagatctgggcg
acccaaagctctacactgattgaagtcctggccaaagccggtatcaactctgatgaaatc
gcgggtatcggtattaccaatcagcgcgaaaccacgattgtttgggataaagtgaccggt
aagccggtgtataacgccattgtctggcaatgccgccgtactgcggatatttgcgaaaaa
ctgaaaaaagaagggctggaagagtatatccgccacaacaccggtttggtggtagatccc
tacttctctggcacaaaagtgaaatggatcctcgataacgtcgagggcgctcgcgagcgc
gctgaacgcggtgagttactgtttggtaccgtagacacctggctggtgtggaatatgacg
caaggccgtgtgcacgtcaccgactataccaacgcatcacggaccatgatgtttaacatc
cgtaccaaggagtgggacgaccgtatgctgaaagcgctgaatattccacgcgccatgcta
ccggaagttcgcccatcctccgaaatctacggcaaaaccaatatcggtggcaaaggtggc
actcgtattccaatcgccgggattgccggtgaccagcaagccgctctgtttggtcagctt
tgtgtacagccgggcatggcaaaaaatacctacggtacgggttgcttcctgctgatgaac
accggtgaagaagcggttcaatctactcatggcctgttgaccaccattgcctgtggccca
cgcggtgaagtgaattatgcactggaaggggctgtatttattggtggtgcctccattcaa
tggctacgtgatgaattgaagttgataggcgatgccaccgattctgagtatttcgcgacc
aaagtgaaaaacagtaatggtgtgtatgtggtaccggccttcaccggtctgggcgctcct
tactgggacccgtatgcccgtggtgcgattttcggcctgacccgtggtgttaacagcaac
cacattatccgtgcaacgctcgaatccatagcttatcagacccgcgatgtcttggatgcc
atgcaagctgactccggcgcacggctgaaatcactgcgtgttgatggcggtgcagtagct
aataacttcctgatgcagttccaggccgatattctgggtacccgtgttgagcgccctgct
attcgtgaaagtacagcattgggtgctgcattcctggcaggtctggcgacgggcttctgg
gatgacctcgatgaggtgaagagtaaagcaagcattgaacgcgaattccgtccagggatt
gaaaccacagagcgtgatatccgttacaagggctggaaaaaagcagtggcccgcgcccgg
gattgggaagagcacgacgagtaa

DBGET integrated database retrieval system