KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB0081Help
Entry
YPTB0081          CDS       T00195                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00010  Glycolysis / Gluconeogenesis
yps00051  Fructose and mannose metabolism
yps00562  Inositol phosphate metabolism
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01130  Biosynthesis of antibiotics
yps01200  Carbon metabolism
yps01230  Biosynthesis of amino acids
Module
yps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yps_M00002  Glycolysis, core module involving three-carbon compounds
yps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTB0081 (tpiA)
   00051 Fructose and mannose metabolism
    YPTB0081 (tpiA)
   00562 Inositol phosphate metabolism
    YPTB0081 (tpiA)
Enzymes [BR:yps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPTB0081 (tpiA)
Exosome [BR:yps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPTB0081 (tpiA)
  Exosomal proteins of bladder cancer cells
   YPTB0081 (tpiA)
  Exosomal proteins of melanoma cells
   YPTB0081 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAH19321
UniProt: Q66GA1
Position
complement(93800..94567)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctaggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system