KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB0205Help
Entry
YPTB0205          CDS       T00195                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPTB0205 (pldB)
Enzymes [BR:yps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPTB0205 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245803..246816
Genome map
AA seq 337 aa AA seqDB search
MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPIRYVRFRAPHHTQVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDHNRGHVIKFDDYIEDFA
QLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVALCAPMFGIHLPLPGWLAR
RIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYSDTPEIRVGGPTY
HWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAMTLAGHPCEGGRPQ
VIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaggtcatcacatgaataattggttaacccgagaagagcaatttgctgctttt
attaatgggccattgttggatttctggcagcaacgagacgaacagacgtttatgggcgtc
gataatatccccattcgctatgtccgttttcgtgcgccgcatcatacccaagtcgtggtg
gtagtgccggggcgtatcgaaagttacgtcaaataccctgaagttgcttatgacctgttc
cagcagggctatgatgtgatagtgctggatcatcgcgggcaagggcgttctgggcgtatg
ctggatgatcataaccgtggtcacgtgattaagttcgatgactatattgaggattttgca
caactggtgcagatcgaaattaccggtagccattatcagcagcgttttgcgctggcccac
tcaatggggggcgcgattctgacgcgttttctagccagagagcctgatgtatttaatgcc
gttgcgttatgtgcgcccatgtttggtattcatttacccctgccgggctggttggcacgc
cgtattgttaactgggccgaagggcaccaaaagctacgggattattacgcgattggtact
gggcattggcggccactgccgtatttggtcaatatgctgactcacagccgcgagcgttat
cgccgctatttgcgccaatattcagacacaccagaaatccgcgtgggtggccccacttac
cattggctacgtgaaagtttgctggtgggggagcaaattattgctgaagcggagaaaatc
accactccggtattattgttacaggccagtgaggatcgggtggttcataacccagcccac
gatgctttttctcaggcaatgacattggcagggcacccctgtgaaggggggcgtcctcag
gtcattcaaggcgcacgccatgagatcctgtttgagcgggacacgctgcgtgccgaggcg
cttagcgccatattgcgctttttcgcgcaacatcaatcatcagtcggccattag

DBGET integrated database retrieval system