KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB0267Help
Entry
YPTB0267          CDS       T00195                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00071  Fatty acid degradation
yps00280  Valine, leucine and isoleucine degradation
yps00281  Geraniol degradation
yps00310  Lysine degradation
yps00362  Benzoate degradation
yps00380  Tryptophan metabolism
yps00410  beta-Alanine metabolism
yps00640  Propanoate metabolism
yps00650  Butanoate metabolism
yps00903  Limonene and pinene degradation
yps00930  Caprolactam degradation
yps01040  Biosynthesis of unsaturated fatty acids
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01130  Biosynthesis of antibiotics
yps01200  Carbon metabolism
yps01212  Fatty acid metabolism
Module
yps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPTB0267 (fadB)
   00650 Butanoate metabolism
    YPTB0267 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    YPTB0267 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    YPTB0267 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPTB0267 (fadB)
   00310 Lysine degradation
    YPTB0267 (fadB)
   00380 Tryptophan metabolism
    YPTB0267 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPTB0267 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPTB0267 (fadB)
   00281 Geraniol degradation
    YPTB0267 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPTB0267 (fadB)
   00930 Caprolactam degradation
    YPTB0267 (fadB)
Enzymes [BR:yps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPTB0267 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPTB0267 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPTB0267 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     YPTB0267 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAH19507
UniProt: Q66FR8
Position
complement(313445..315634)
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALNVLEKQSELKGLLLRSA
KTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDALK
IGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGRV
MQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQYVK
AQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAAKLL
NKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEALIGE
DTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHQMPLVEIIRGAKTSDKTLAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDKLLAEISQPLQEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVY
GLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAAL
LDVSTNQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacattacagcttcactggttggaaaacggtattgccgagttg
gtatttgatgctccgggttcagttaataaactggatactaaaaccgtagccaatttgggt
gaagccttgaatgtgttagaaaaacaaagtgaactcaaagggttgctattacgttcagcg
aagacagccttgattgttggtgccgatattactgagtttctatccctgtttaatgcccca
ccagaaaaactgcaccagtggctggtgttcgccaacaccattttcaatcgactggaagat
ttacccgtgccaaccatttcagcaattaatggatacgcactaggtggaggatgtgaatgt
attttggcgacggatttccgtatcgcctccccagaagcacgtatcggcctcccagaaacc
aagttgggcatcatgccgggcttcggtggttcggtccgtttgccacgcctgctaggcgct
gatagtgcacttgagattattgccacaggtaaagatgttactgccaacgatgcactaaag
attgggctggttgatgcagttgtcgaccctgagaaactggtcggttcagccttaactatg
ctgaaacaagctattgacggtaagctcgattggcaggcagcacgccgcccaaaactggaa
cccctaaaacttaatcctaccgaagcggctatgtgttttaccattgctaaaggcagagtc
atgcaagtcgccgggaaacactatcccgcaccattgactgcagtaaaaactattgaagcc
gccgcaaaatttggtcgtaccgaagcgctgaacttggaaaccaacagttttgtcccttta
gcgggttccaatgaagctcgcgctttggtggggatttttcttaacgaccagtatgtaaaa
gcgcaagccaaaaaactgtccaaaggcgtcgctgcaccaaaactggctgcggttctgggc
gcagggatcatgggaggtggaattgcctatcagtcagcgctgaaaagtgtgccagtcatt
atgaaagatattaatgaaaactcgctggatcttggaatgaatgaggccgctaaattactg
aataaacagctggaacgcggcaaagtggatggccttaaaatggcaagtattctggcgact
attcgaccaaccttggattatgcaggtattgaacgagcccaagtgatcgtcgaagctgtg
gtggagaacccgaaggttaaagccgctgtacttgcggaagtagaagcattaatcggtgaa
gataccgttttagcttccaatacctcgacgattcctattgatcagttggctaaatcactc
aaacgccctgaaaatttctgcggtatgcacttcttcaatccagtacaccagatgccactg
gttgaaattattcgtggggcaaaaacctcagataaaacccttgcggcagtagtcgcttac
gctacacaaatggggaaaaccccaattgttgtcaatgattgccctggtttcttcgttaac
cgcgtcttattcccgtatctcgcaggctttggcatgttagtcagagacggtggggatttc
caccaaattgataaagtgatggaaaaacagtttggctggccgatggggcccgcttatcta
ttagatgtcgtcggtattgatactgcccatcatgcacaagcggtgatggctgccggtttc
cctgagcgaatgaacaaggattaccgtgatgcggttgatgtgatgtttgataaccaacga
tttgggcaaaagaatggtcaggggttttaccgctatacgcaagatgcaaagggtaagcca
cgtaaagaaaatgacgaacaagtggataaattactggcagaaatcagccaacctctccaa
gaattcagcgatgaagacattattgcccgcaccatgatcccaatgatcaatgaagtcgtc
cgctgcctggaagaaggtattattgccagcgcagccgagggtgacatggcgctggtttat
ggccttggcttccctccattccacggaggagtcttccgttaccttgatacgctcggtagc
gcaaattatgtcgaaatggctcaacgctatgcccaccttggtgcgttatatcacgttcct
gcggggctacgagctaaagctgaacataacgaaagttattatcctgtggcagcagcgctg
cttgatgtttctaccaatcaaccagcatga

DBGET integrated database retrieval system