KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB0447Help
Entry
YPTB0447          CDS       T00195                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:yps00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530581..531324
Genome map
AA seq 247 aa AA seqDB search
MMLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAHQIIKAGLARLTPDI
PLLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDQGEPVLGVVYVPV
TEVMYSAANGQAWKEECGRRMQIQVRDALPPLVVVSRSHSDAELEDYLSQLGEHQTISVG
SSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKTLSYTPRESFLNP
GFRVSLF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagagcaaattggccagttggcccgtgaggcaggcgtggcgattatggcggtc
tatcagggcgacaaaccccttgatattgcgcataaaaaggatgattcaccggtgacggcg
gctgatttggcggctcaccagattatcaaagctgggttggcgcgattaaccccggatatt
ccgctactctctgaagaggatccacccgcttgggatgtgcgccaacactggcaacgctac
tggctggttgacccgctggacggtactaaagagttcctcaatcgtaacggtgaattcacc
gtcaacatcgctttgattgaccaaggtgaaccggtactgggagtcgtctatgtaccggta
accgaagtgatgtacagcgcggcaaacggacaggcttggaaagaagagtgtggcagacgt
atgcagattcaggtgcgtgatgccctgcctccgttggtcgtggtgagccgctctcatagc
gatgctgaattggaagactatttatcacaactgggggagcatcaaactatttcggtgggc
tcatcacttaaattctgcttggtggcggaagggaaagcgcaactgtacccgcgttttggg
ccaactaacgtctgggatacggcggctggtcatgccgtcgccatcgctgccggggcgcaa
gtacacgattggcagggaaagacactgtcttataccccacgtgaatctttcttgaacccc
ggtttcagagtttcgttattttag

DBGET integrated database retrieval system