KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB0573Help
Entry
YPTB0573          CDS       T00195                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YPTB0573 (holD)
   00240 Pyrimidine metabolism
    YPTB0573 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YPTB0573 (holD)
   03430 Mismatch repair
    YPTB0573 (holD)
   03440 Homologous recombination
    YPTB0573 (holD)
Enzymes [BR:yps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YPTB0573 (holD)
DNA replication proteins [BR:yps03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YPTB0573 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676033..676470
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQQLPEHGDPLLCDVLRS
LGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQLHSPELAGLYQDAGAKRA
LWQQICHYEADFYPDASRSGHSVPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttgctgttacagcagcttggcattacgcagtgggtattgcgc
cgtcctgccgtcttgcagggtgagattgcaatacatttacctgaagatacccgcctactg
attgtggcacagcaactgcctgaacacggtgatccactgttgtgcgatgtgctacgcagt
ttgggcctaaccccccatcaggtttatgccttgacgccggatcaggtcgcgatgttgccg
gaagatacgcagtgcaacagttggcgattgggcatcagtgagccgcttgcggtggccggt
gcacaattacatagcccagaattagctgggctttatcaagatgcgggcgctaagcgcgca
ctttggcagcagatttgtcattatgaagcagatttctatcctgacgccagccgatctggc
cacagcgtaccaaattga

DBGET integrated database retrieval system