KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB0628Help
Entry
YPTB0628          CDS       T00195                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:yps00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:yps00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
746293..746775
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN
IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV
GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct
atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg
gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat
attgtcatcagtagccagcctggcactgatgaacgtgtgacgtgggcggcctcgattgaa
gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggccgcgtc
tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc
ggtggcgatactcacttccctgattatgagccagatgaatgggaaagcgtattcagtgag
tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc
taa

DBGET integrated database retrieval system