KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1148Help
Entry
YPTB1148          CDS       T00195                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutar...
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00020  Citrate cycle (TCA cycle)
yps00310  Lysine degradation
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01130  Biosynthesis of antibiotics
yps01200  Carbon metabolism
Module
yps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPTB1148 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    YPTB1148 (sucB)
Enzymes [BR:yps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YPTB1148 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CAH20388
UniProt: Q66DA1
Position
1373784..1375007
Genome map
AA seq 407 aa AA seqDB search
MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKVILEVPASQDGILDAI
LEDEGATVTSRQVLGRIRPSDSSGKPTEEKSQSTESTPAQRQTASLEEESNETLSPAIRR
LIAEHDLDATAIKGSGVGGRITREDVDSHLASRKSASAVVADAKAVAAAAPVLAGRSEKR
VPMSRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTLSMADIEKK
IKELAVKGRDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGRESVGYLVTVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattaatgttcctgacctccctgagtctgtagccgatggctctgta
gcaacctggcacaaaaaaccaggcgacagcgtcaaacgtgatgaagtgctggttgagatt
gaaacggataaagtgattttggaagtgccagccagtcaggacggtattttggatgccatt
ctggaagatgaaggtgccacagtgacgtcacgtcaggtgctggggcgcattcgtccaagt
gatagttctggtaaaccgactgaagaaaaaagtcagagtacggagtcaactccggctcaa
cgccaaacagccagcttggaagaagaaagtaatgaaaccctcagtccggctattcgccgc
ctgattgctgagcatgatctcgatgcaacggcaatcaaaggcagcggtgttggtggccgt
atcacccgtgaagacgttgatagccatttagcgagccgtaaatcggcctctgcagtggta
gctgacgctaaagcggtagccgctgctgcacctgtattggcggggcgtagtgagaaacgt
gtcccgatgagccgtctgcgtaaacgtgttgctgagcgtctgttagaagcgaaaaacagc
actgcaatgttgaccacgtttaacgaaattaatatgcagcccattatggacctgcgtaag
cagtacggtgaagcttttgagaaacgccacggtgtacgtctgggctttatgtccttctat
atcaaggcagtggttgaagcactgaaacgttatcctgaagtgaatgcttctattgatggc
gaagatgttgtctaccataactatttcgatgtcagtattgcggtttctactccacgtggt
ttggtaacgccagtattacgtgatgtagacacgttgagcatggctgatattgagaagaaa
ataaaagaattggctgtaaaaggtcgtgatggcaagctgaaagttgaagagttgactggc
ggtaactttaccattaccaatggtggcgtgtttggctcactgatgtcgacaccaatcatt
aacccaccacaaagcgcgatccttggcatgcatgccatcaaagatcgcccaatggcggta
aatggtcaggttgtgatcctgcctatgatgtatttggcactttcctacgatcaccgtttg
atcgatggccgcgagtctgttggctatctggtgacggtaaaagagatgctggaagatcct
gctcgcttgctacttgatgtataa

DBGET integrated database retrieval system