KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB1166Help
Entry
YPTB1166          CDS       T00195                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPTB1166 (gpmA)
   01230 Biosynthesis of amino acids
    YPTB1166 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTB1166 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YPTB1166 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPTB1166 (gpmA)
Enzymes [BR:yps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YPTB1166 (gpmA)
Exosome [BR:yps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YPTB1166 (gpmA)
  Exosomal proteins of melanoma cells
   YPTB1166 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1392836..1393588)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKTWKLNERHYGALQGLNKSETAEKYGDEQVKQWRRGFA
ITPPALEKSDERFPGHDPRYAKLTDAELPTTESLALTIERVIPYWNDVIKPRIASGERVI
IAAHGNSLRALVKYLDDLGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagctagttttggtacgacacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgaaaaaggccgttctgaagcaaaggca
gcgggtaagctgttaaaagatgaaggcttcacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggaacattttggatgaattagatcaggcatggctgcca
acagaaaaaacctggaagcttaacgagcgtcactacggcgcactgcaaggcctgaataaa
tctgaaactgctgaaaaatacggcgatgagcaggttaagcaatggcgtcgtggctttgcc
atcacccctccagcactggagaaaagcgatgagcgtttcccaggccatgacccacgttat
gcaaaattgactgatgctgagctgccaaccacagaaagcttggcgctgactattgaacgc
gtgattccctactggaatgacgttatcaaaccacgtattgccagcggtgaacgcgtaatt
attgctgctcacggtaactctttacgtgcattggtaaaatatctggatgatctgggcgaa
gacgaaattcttgagctgaacatcccaactggcgtgccattagtgtatgagtttgatgag
aacttcaagcctatcaaacactactatctgggtaacgctgatgaaatcgccgctaaagct
gcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system