KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB1520Help
Entry
YPTB1520          CDS       T00195                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:yps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1826650..1827354
Genome map
AA seq 234 aa AA seqDB search
MLVLSGCVSLLEKRMSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVM
HLLNLDLTDDSLADTPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLT
STCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLG
TNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcttatctggatgcgtaagcctgttggagaaaagaatgtcatcgctaagtaaa
gaagctgagttggttcatcaagcgctgctggcccgtggtcttgaaacccctttacgtaaa
ccagaattagatgccgagacgcgcaaaactcggattcaggcccatatgacagaagtcatg
catttgctgaatcttgatttaaccgacgatagtctggctgatacaccaagacgcattgcg
aagatgtatgttgatgagattttctccggattggattacgaaaatttccctaaaatcaca
ctgattcaaaataaaatgaaagttgatgaaatggtaacggtacgggatatcactctgacc
agcacctgcgaacatcattttgtgacgattgatgggaaagccaccgtcgcttatattccg
aaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtgcagttttttgcgcagcgt
ccgcaagtgcaggaacgattaacacagcagatcttgctcgcattacaaaccctgttgggt
accaataatgtcgcagtttctattgatgcagttcattattgcgttaaagcacgtggtatc
cgtgatgcgaccagcgcgacgaccaccacatcattaggtgggttatttaaatccagtcag
aatacgcgtcaggaatttctgcgtgcggttcgtcaccacggctga

DBGET integrated database retrieval system