KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB1717Help
Entry
YPTB1717          CDS       T00195                                 

Gene name
YedO
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:yps00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2071460..2072452
Genome map
AA seq 330 aa AA seqDB search
MTLQHKLTQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPVALGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTEQANYLTNGNRLLL
DLFNVDVVMCEALNDPNQQLAELATRVEAQGFRPYVVPIGGSNALGALGYVQCSLEIAAQ
AAGNVAFSSVVVASGSAGTHAGLAVGLQQLLPDAELIGVTVSRSADEQRPKVAQIQQALA
TSLGMTDPLAKITLWDSYFAPQYGMPNEEGIAAIKLLARLEGILLDPVYTGKAMAGLLDG
IEQQKFCDKGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacacaaactgacgcaattcccgcgtctcgatctggtcggtaatgcgacg
ccattagaaaagctgtctcgtctatctgattatctgggacgtgaaatttacattaaacgt
gatgatgtcacgcctgtggcgcttggcgggaataaactgcgcaagctagaattcttagcc
gcagatgccttgagacagggagccgatacgctggttacggctggtgctattcaatctaat
catgtccgccaaaccgccgccgtggccgcgaaactggggctgcattgcgttgcgctgttg
gaaaaccccattggtactgagcaggcaaactatctgaccaatgggaaccggctgttactg
gacctattcaatgttgatgttgtgatgtgtgaggcattgaacgatccaaatcagcaatta
gcagaattggctacccgcgtggaagcgcagggtttccgcccatatgtggtaccgattggc
ggttctaatgccttgggcgcgctgggttatgtgcagtgctcactggaaattgctgctcaa
gccgcgggcaatgttgcgtttagttcggtcgtcgtggcctctggcagtgcgggaacacat
gcaggattggcggttggtctacagcagttgttacccgatgcggaattaatcggtgtgacg
gtatcacgtagtgccgatgaacagcggcctaaagtggcacagattcaacaagcgttggcg
acatcattagggatgacggacccattggcaaaaatcaccttgtgggatagttattttgcc
ccgcaatatgggatgccaaacgaagaggggatagcggctattaagctcttggcaagactg
gaaggaatattgttggaccctgtgtataccggtaaggcgatggcgggcttacttgatggt
attgaacagcaaaaattctgcgacaaagggccaattttatttatccacactggcggggca
cctgcgctgtttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system