KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB1755Help
Entry
YPTB1755          CDS       T00195                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Brite
Enzymes [BR:yps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     YPTB1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2109845..2110351)
Genome map
AA seq 168 aa AA seqDB search
MNSIVKRCLVGVILALAATLPNYQTLKASPAGLKLIADYEGCQLNAYQCSANVWTNGIGH
TVGVKPGSVISERQVAVNLVADVQRVERAIAVCMPVTMPQPVYDAVVSFAFNVGPGAACR
STLAFFVNKSDWHSACNQLPRWVYVNGVKTKGLERRRVTEQKHCLSGA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaatcgttaagcgttgtctggtcggcgtcattctggcgctggccgccacctta
ccgaactaccagaccttaaaagcatcgcccgccgggctaaaactgattgcggattatgag
gggtgtcagctcaacgcctaccagtgcagcgccaacgtttggacaaatggcatcggccac
acggtcggggttaagccgggcagcgtgatcagtgaacgacaggtggcggtcaatctggtt
gctgacgtgcagcgggtcgaacgggctatcgctgtctgtatgccggtgaccatgccgcaa
ccggtgtatgacgcggtagtgtcgtttgcctttaacgtcggccccggcgctgcttgccgc
tcgacgctggcattttttgtcaacaagagtgactggcacagcgcctgtaatcagttgccg
cgctgggtctatgtcaatggcgtgaaaaccaaagggttagagcgccgtcgtgttacagag
caaaaacactgcttgagcggggcctga

DBGET integrated database retrieval system