KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB2415Help
Entry
YPTB2415          CDS       T00195                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:yps00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:yps00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:yps00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2854533..2857733
Genome map
AA seq 1066 aa AA seqDB search
MTSQEKVPFQVQLSLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQ
TLNGLWSFSYFTQPEAVPEHWVRCDLAEAKPLPVPANWQLHGYDAPIYTNIQYPIPVNPP
RVPDLNPTGCYSRDFTLEPSWLASGKTRIIFDGVSSAFYLWCNGQWVGYSQDSRLPAEFD
LTPYLQAGSNRIAVLVLRWSDGSYLEDQDMWRMSGIFRDVKLLHKPEIHLRDIHIMTHLS
PEFTSANLEVMAAVNIPSLQLNDPQVTGSYQLRVQLWLADKLVASLQQPLGTQAIDERGP
YTDRTQLVLRIDQPLLWSAEQPTLYRAVVSLLNHQQELIEAEAYDVGFRQVAIHQGLLKI
NGKAVLIRGVNRHEHHPQTGQAIDEESLLQDILLMKQHNFNAVRCSHYPNHPLWYRLCDR
YGLYVVDEANIETHGMQPMSRLSDDPSWFSAFSERVTRMVQRDRNHPCIIIWSLGNESGH
GATHDALYRWIKTNDPTRPVQYEGGGANTLATDILCPMYARVDEDQPFPAVPKWSIKKWI
GLPNESRPLILCEYAHAMGNSFGGFARYWQAFRQYPRLQGGFIWDWVDQSLTHHNDHGQP
YWAYGGDFGDTPNDRQFCMNGLVFPDRSPHPSLYEAQCAQQFFQFSLLSTTPLVINITSE
YLFRESDNEQLYWRIMLEGESVLEGSQPLNLSPESSQCYRLAEKLPTLNKPGQLWLNVEI
RQPKETPWSPAQHRSAWHQWRLPQPLFSPSSDLTNATAHYAPQLQHNLQLQHNRQLQHDL
QLQQDEQHIKVTYQQQCWQFSRQTGRLDQWWVADKPMLLRPLQDQFVRAPLDNDIGISEA
THIDPNAWVERWKKAGMYQLQQRCLSLHVDHLSHSVQISAEYGYEFEQEPLLHSHWVYRF
DRHGRMTIDVNVRIATSLPAPARIGMCCQLADISPTVEWLGLGPHENYPDRQLAAQYGHW
SLPLEQMHTAYIFPSENGLRCNTHTLNYGRWTLTGDFHFGISRYSTQQLMVTSHQHLLEP
EEGTWLNIDGFHMGVGGDDSWSPSVHIDDILTRETYQYQICWQYKV
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacaggaaaaggtaccattccaggtgcaactgagtcttccccagattttgtcc
cgccgagattgggaaaacccgcagatcacacagtatcatcgcctggaggcccacccgcct
tttcacagttggcgtgatgtagaatctgcccagaaggatcgtccttcaccacagcaacaa
acactcaatgggctatggtcattcagctatttcacacaacctgaagcggtacccgagcac
tgggtgaggtgcgatttagccgaggcaaagccgctccctgtaccggctaactggcaactt
catggttatgacgcaccaatttacaccaatatacaataccctattcccgtcaacccacca
cgggtcccggatctaaatccaacgggttgctattcccgtgatttcacgttagagccaagc
tggttggcatcgggtaagactcgcattatttttgacggtgtcagttctgcattttatctg
tggtgtaatgggcaatgggtaggttattcacaagacagccgcctacctgctgagttcgat
ctcaccccctatttgcaggctggcagtaaccgtatcgcagttttagttctgcgctggagt
gatgggagttatcttgaagatcaagatatgtggcgtatgagcggaatttttcgtgatgtg
aaattgttgcataaacccgagattcacttacgggatatccacatcatgacgcatctatcc
cctgaattcacctctgcaaatttagaggtaatggcggccgtcaatatcccctctctacag
ctcaatgatccgcaggtgaccggatcctatcagctccgtgtacaactttggttagccgat
aaattggtcgccagtttacaacagcctttaggcacccaagccattgatgaacgaggtcct
tatactgatcgtacccagctagtattgcgaatagatcagcctctgctctggagtgccgag
cagccgacgctataccgagccgtggtttccttgctcaatcatcagcaagaattgattgag
gccgaagcctatgacgtgggtttcaggcaagtggcaatccatcaaggcttgcttaaaatc
aatggcaaagcggtgctgatcagaggggtgaatcgacatgaacatcacccgcaaacaggt
caggccattgatgaagagagtctgttgcaagacattttattaatgaaacagcataatttt
aatgctgtgcgctgctcccactatcccaatcatcctttatggtaccgcctttgtgaccgc
tatggtttgtatgtggttgatgaagcgaatattgagacacacggtatgcagcccatgagc
aggctgtccgatgacccaagctggttttcagctttcagtgaacgggtgacgcggatggtt
cagcgagatcgcaaccatccatgcattattatctggtcactgggcaatgaatcaggccat
ggcgcaacccatgatgccctctatcgttggataaaaaccaatgaccccacccgccctgtg
caatatgaagggggcggtgccaacaccttagcgaccgacattctgtgtccgatgtatgcc
cgtgttgatgaagaccagccctttcctgccgtccccaagtggtcaatcaaaaaatggatt
ggcttaccgaatgaatctcgccccttgatcctatgtgaatacgcccatgcgatgggcaat
agcttcggtggatttgcccgctattggcaggcatttcgtcagtacccgcgcttacagggc
gggtttatttgggactgggtagaccaaagtctgactcatcataatgaccatggtcagcct
tattgggcgtatgggggtgattttggtgatactcccaatgaccgccagttctgcatgaac
ggattagtcttccctgaccgcagcccgcacccgagcctttatgaagcgcagtgcgcacag
caattcttccaattttcgttgctgagtacgaccccgttggtgatcaacattaccagtgaa
tatttgttccgagagagtgataacgaacaattatattggcggataatgttagagggagaa
tccgtgttggagggtagccaacccctgaatttgtcgcctgaaagctcacagtgctacagg
ttggcagagaaattacccacgcttaataaacctgggcagctatggctgaatgttgagata
aggcaaccaaaagaaaccccgtggtcccctgctcaacatcgcagtgcctggcatcaatgg
cgcttaccacaaccactcttttcgccgtccagtgatctgaccaatgctacagcgcattat
gcccctcaactgcaacataaccttcaactacaacataaccgtcaactacaacatgacctt
caactgcagcaagatgaacagcatattaaggtgacttatcagcaacaatgctggcaattc
agtcgtcaaacggggcggttggatcaatggtgggtggcggataaaccgatgctactgcgc
ccactacaagatcaatttgtgcgtgcgccgctggataacgatatcggtatcagcgaagct
acgcatattgaccccaatgcttgggttgagcgctggaagaaagccggaatgtatcaactc
cagcaacgctgcctctctctacacgtagatcatttatcccattcagtacaaatcagtgcc
gaatacggttatgaattcgagcaagagcccttgctacacagccattgggtataccgtttt
gaccgacatggccgtatgaccattgatgttaacgtccgtatcgctacctcactccctgcg
ccagccagaattggcatgtgttgccaactggctgatatctcacctacggttgaatggcta
gggttggggccacatgaaaactaccctgatcggcagcttgcagcacaatatgggcactgg
tccctgccattagagcagatgcacaccgcgtatattttccccagtgagaatggcttgcgc
tgcaatacccatacgctgaattatggccgctggacgttaacgggcgatttccactttggt
ataagtcgctacagcacccagcaactgatggtgacctcccatcaacatctattggaaccc
gaagagggcacctggctcaatattgatggtttccatatgggggtgggcggtgatgattca
tggagcccgagtgttcacattgatgacatactcacccgtgaaacctatcagtaccaaatc
tgttggcaatacaaggtgtaa

DBGET integrated database retrieval system