KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB2449Help
Entry
YPTB2449          CDS       T00195                                 

Gene name
ycfO
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPTB2449 (ycfO)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    YPTB2449 (ycfO)
Enzymes [BR:yps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YPTB2449 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2896150..2897181)
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLVVA
VDQEGGRVQRFRDGFTRLPAAQSFAAINDAATAAQLAQEAGWLMAAEMMAMDIDISFAPV
LDIGHVSAAIGERSFHSDPQQARIMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETP
HDNRPLAEILTHDMVIFRELIQRKLLDAIMPAHVIYTEADARPASGSAYWLQEILRQELG
FEGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPIKADQL
TRLYHSGQFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcccgtgatgttagatgttgccagctatgagctggatgctgaagagcgtgagatt
ttaaaacacccactggtgggagggttgatcttattcagccgtaattttcatgatgcggag
cagttacgcgaattagtacgccaaatccgtgcagcatcgcatgaacgtttggtggtcgca
gtggatcaggaaggggggcgggtccaacgctttcgtgacggttttacccgcctgccagcg
gctcagtcttttgcggctatcaatgatgccgctactgcggctcaactggcgcaagaggcg
gggtggttgatggcagcagaaatgatggcgatggatatcgatatcagttttgctccagta
ctggatattggccatgtcagcgccgcaattggtgagcgttcattccacagtgatccacaa
caggcgcggataatggcggagtgtttcatccgtgggatgcacagtgcagggatgaaaacc
acgggcaagcattttccagggcacggcgcagtaaccgcagattcacataaagagacgcca
catgataatcggccactggcagaaatccttactcatgatatggttatatttcgtgaattg
atccagcggaaattactggatgcgattatgcctgctcacgtgatttataccgaagccgat
gcacggcctgccagcggttctgcctattggttacaagagatattgcgccaagagctaggg
ttcgagggcatcattttctctgatgatctctcgatggaaggggctgcgatcatgggcagt
tacgccgagcgcggccaggcatcgttggatgccggttgcgatatgattttggtgtgtaat
aaccgtcagggggccgtgagtgtgctggataatctgtctccgatcaaagccgaccaactg
acccgtttgtaccattcagggcaatttgaccgccagacattgatggcttcatcccgttgg
caacaggcgaataaagcattaacggcactcagcgaacgttgggatgcacataaacaaacg
ttggggcaatag

DBGET integrated database retrieval system