KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2636Help
Entry
YPTB2636          CDS       T00195                                 

Gene name
faoA
Definition
(GenBank) putative fatty oxidation complex alpha subunit / enoyl-CoA hy...
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00071  Fatty acid degradation
yps00280  Valine, leucine and isoleucine degradation
yps00281  Geraniol degradation
yps00310  Lysine degradation
yps00362  Benzoate degradation
yps00380  Tryptophan metabolism
yps00410  beta-Alanine metabolism
yps00640  Propanoate metabolism
yps00650  Butanoate metabolism
yps00903  Limonene and pinene degradation
yps00930  Caprolactam degradation
yps01040  Biosynthesis of unsaturated fatty acids
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01130  Biosynthesis of antibiotics
yps01200  Carbon metabolism
yps01212  Fatty acid metabolism
Module
yps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPTB2636 (faoA)
   00650 Butanoate metabolism
    YPTB2636 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    YPTB2636 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    YPTB2636 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPTB2636 (faoA)
   00310 Lysine degradation
    YPTB2636 (faoA)
   00380 Tryptophan metabolism
    YPTB2636 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPTB2636 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPTB2636 (faoA)
   00281 Geraniol degradation
    YPTB2636 (faoA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPTB2636 (faoA)
   00930 Caprolactam degradation
    YPTB2636 (faoA)
Enzymes [BR:yps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPTB2636 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPTB2636 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPTB2636 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAH21874
UniProt: Q668V1
Position
complement(3113963..3116305)
Genome map
AA seq 780 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTLHSNSTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDSS
IYTLLGVTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLG
GPFRYLDSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgttagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcattacgc
agcctatttttcgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcacaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacactgcattcaaattccacaaaaaattcatctccaacaaaaaatgggaattct
ccggcgaagcgtaatagctttaagtggagaaaaaacaaagtaaaaccagtcgattccagt
atctataccttgttgggggtgacacctaaagcccatcttggtgcaggcgtgattactcaa
cgttgtaccatgctgatgttgaacgaagcggtacgctgtctggatgaatcgatcattcgt
aacccgcgcgatggtgatattggtgcagtgtttgggatcggttttccgcctttcctcggt
ggtccgttccgctatttggatagcctgggagccgataaggtggtacaagcactcagatta
ttggtacagcaatacggtgagcgtttcgaaccttgccagcggttggtaacaatggctgaa
caacaacaacaattctatcccgtggacgccaatatagatgaggtgacggacgtggcaagc
tga

DBGET integrated database retrieval system