KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB2775Help
Entry
YPTB2775          CDS       T00195                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yps01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:yps00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3279389..3280516
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYTLEWVLSGQPFLTAKGAL
VDAVVNAVKHYTEITPQLLTTGGTSDGRFIALMGAQVVELGPVNATIHKVNECVSAADLQ
LLSRMYQKIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggttcc
atcactgctaacttgcgtattcatggggtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggtcgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgtcatcagctt
gattacaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgttg
gtggatgccgtggttaatgccgttaagcattacactgaaatcacaccgcaactgttaacc
accggggggacgtcagatggccgctttattgcgttaatgggggcgcaagtggttgagttg
gggccagttaatgccaccattcataaagttaatgaatgtgttagcgcggctgatttacaa
ttgctcagccgtatgtaccagaaaatcatggaacaactgatcgcatga

DBGET integrated database retrieval system