KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2999Help
Entry
YPTB2999          CDS       T00195                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00900  Terpenoid backbone biosynthesis
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPTB2999 (dxr)
Enzymes [BR:yps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     YPTB2999 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CAH22237
UniProt: Q667J3
Structure
PDB: 

Jmol
Position
complement(3538029..3539225)
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEH
SAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQV
LLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSR
IILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYVEARWLFN
ASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFC
KVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVIN
RTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAKLNN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgactattcttggctctactggctccatcggcaacagcacgttgagtgtt
gtgcgtgcaaaccctgaattatttaaagtcacggcgttagttgccgggcgtaatgtcagg
gaaatggcgcagcaatgccttgagttctccccccgctatgcagctatgtctgatgaacac
tcagctaaatcactgcgtttattgttggcagaacagggttcagacaccgaggtctattcc
ggtgaaacggctgcctgcgaattggcagctttagatgatgtcgatcaagtgatggccgcg
attgttggcattgctggtttaccctcaacattggccgctattcgtgcaggtaaacaagtc
ttgcttgccaataaagagtcgctgattacctgcggtaaactctttatggatgaggttaaa
cgcagccgtgctcaattactgccaattgatagcgagcataacgcgatttttcagagtttg
cctgaaagaattcagcgccaattaggctattcttcattaaatgaaaatggcgtttcacgg
attattttgactggctctggtggcccatttcgtgaaactccactttcgcagttttctgat
gtcaccccagatcaagcttgtgctcatccaaattggtctatggggcggaaaatttctgtc
gactcagcgacgatgatgaataaaggcctggagtatgttgaggctcgatggttatttaat
gccagcgcagaacagatagaggttgtgttacatccgcagtctgttattcactcgatggtt
cgctatcatgacggaagtatcctggcacaaatggggactccagacatgcggacaccgatt
gcacatgcgatggcttacccaatgcgagttagctcaggtgttgcgccattggatttttgc
aaagtaggcgcgctgacctttacaaccccggattatcaacgttatccgtgcttaaagttg
gccatagacgcctgtaatgcggggcaggcagcgacaacagcgctgaatgcagcaaatgaa
atttcagtcatggcatttttagattcaaaaattcgtttcactgatattgaagtgattaac
cgtactgttgttgaaggtttattattatcagaacctaccagtgtggaagaggtgttggtg
attgatcgcaaagctcgtgatgtcgcggcccaagtcattgcaaaattaaataattaa

DBGET integrated database retrieval system