KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB3024Help
Entry
YPTB3024          CDS       T00195                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yps03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3565860..3567818)
Genome map
AA seq 652 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAAPTGKAAARLTESLGKAIR
QFSLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNAGEYRQ
ALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFGRYQLL
CALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLFNGDIG
IALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFM
PVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcggttacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattaaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctctcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactaaccaataaggcattagccaataaagcgcagccagatgaaacc
tattctgattcagcgaatgtacgcgatagcctgtgtttactgcgtaaaagttaccgcttc
gatgaaaagtcagggattgggcagcttgctctggccgttaatgcaggggagtatcggcag
gctttatccgtattaaacagtgcgtattctgatgttgaacgcttcccgctggccgatgag
gaagattatcaggtactgctagaggcttgtgctgtggggtatcagcattacctcgaacgg
gtggctgcgttagcccctgcggcagaggtattggcagcatttggccgctaccaactgctg
tgtgcattacgttccgggccattcggtgtcagtggcttaaacgaacgcattgaacaggtt
ttacatcgtaaaggattcattatccgtccatcagggccttctggccgttggtatgttggg
cggccagtgatgatagaacttaatgatagcgcacttggcttattcaacggggatattggt
attgccttacatgataatgaaggcgagctacgggtatattttcaattgcccgatggcaat
ataaagtcagtacaacctagtcgccttcccagccatgaaaccgcttatgctatgacggtt
cataaatcgcagggttcagagtttgaacacacagcattggtattacctaacacgttcatg
cccgtgttaactcgtgaattggtctataccgccattacccgcgcccgtcagcatctgacg
ctttattgcagcgatgccgtgctaagtcatgccatacgtacaccgactctccggctgagt
gggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system