KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB3656Help
Entry
YPTB3656          CDS       T00195                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPTB3656 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YPTB3656 (aceA)
Enzymes [BR:yps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YPTB3656 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4362400..4363707)
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHG
GSRKGYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctctcgtactcaacaaattcagcagttggaacaggaatggacatcgccgcgc
tggaaaaatatcactcggccttatagcgccgaagatgttatcaagctgcgtggttcggtc
aatccagaatgtacgttcgcacaaaatggtgccaaaaaactgtgggaattgctgcacggc
gggtcgcgtaaagggtatatcaactgtctgggggcattaaccggtggtcaggcgctacaa
caggcgaaagccggtgttgaagccatttatctgtcgggatggcaggtggcggctgatgct
aatacggcatctagcatgtatccagatcagtcactgtatccggtcgactctgtgcctgcg
gtggtgaaacgtatcaacaatagcttccgccgcgctgatcaaattcagtggtcgaataat
attgagccaggtagtaaaggctataccgactatttcctaccgatcgtcgcggatgcggaa
gcgggttttggcggtgtgctgaacgcgtttgaattaatgaaagcgatgattgaagcgggg
gcggcaggggttcattttgaagaccaattggccgcagtgaaaaagtgtgggcatatgggc
ggtaaggtactggtgccgacacaagaggccattcaaaagctggttgctgcccgtttagcc
gcagatgtcttgggtgtaccaacgctgttgattgccaggactgatgcggatgcggctgat
ttattgacctcagattgcgatccctatgaccgggagtttattaccggcgaccgtactgcg
gaaggttttttccgcacccgtgccggtattgaacaagcgatcagccgtggtctggcgtac
gccccttatgctgatttggtgtggtgtgaaacctcgacacctgatctggctctggccaaa
cgttttgccgatgctgttcatgctcaattccccggaaaattactggcttataactgttca
ccctcctttaactggaagaagaatctgaccgaccagcaaattgccagcttccaagatgaa
ctctccgccatgggctacaaataccagtttattacgctggcgggtattcatagcatgtgg
ttcaacatgttcgatctggcccatgcgtatgcgcagggtgaaggcatgaaacactacgtt
gagaaagtccagcaacctgagtttgcctctgtggaccgcggctacacctttgcttcccat
cagcaagaagtggggactggctacttcgataaagtcaccaatattattcaggggggcgca
tcatctgtaacggcactgaccggttcgacggaagagcagcagttttag

DBGET integrated database retrieval system