KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB3657Help
Entry
YPTB3657          CDS       T00195                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00620  Pyruvate metabolism
yps00630  Glyoxylate and dicarboxylate metabolism
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01200  Carbon metabolism
Module
yps_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yps00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YPTB3657 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    YPTB3657 (aceB)
Enzymes [BR:yps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YPTB3657 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CAH22895
UniProt: Q664W2
Position
complement(4363754..4365352)
Genome map
AA seq 532 aa AA seqDB search
MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLATRASWQQTIDQG
ALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGLHLPEKHVKWQD
EAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFNFTEQRFGLSQG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHPNRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVRADKELEASNGH
DGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCSGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSNGQTVTKELFRS
MLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacagttagcgggcacagagttagttttcacccagccttttaatgctgctgag
cggcaggttttaccggataaagccatcgagtttctaaccgaattagtggtgaaatttagc
gaatcgcgtaaccaactccttgccacaagggcatcttggcagcaaaccatcgatcagggg
gcgttacccgattttattttggaaactaattccattcgtgatggtgattggaaaatccaa
ggtattcctgctgacttacgcgatcgtagagttgagatcaccgggccagtagagcggaaa
atggtgatcaatgcgcttaatgccaacgtaaaagtttttatggcggatttcgaagattca
ctggcacccagttgggataaagtgattgatggtcaaattaatctgcatgatgcggtgaaa
gggacaatttcctatacgaatgaatcgggcaaggtctatcaattaaaacctaatcccgcg
gtattgattgcacgtgttcgtggcctgcacttaccggaaaaacatgttaaatggcaggac
gaggcgattcccggtggtttattcgatttcgctttgtatttctaccataactatcagcaa
ctgctggcgaagggcagcggcccttatttctatttgccgaagatgcagtcatatcaggaa
gccgcttggtggagcgatgtgttcaattttaccgagcagcgctttggtctatcgcagggc
accattaaggcgacggtattaattgagacattacccgccgttttccaaatggatgaaatt
ctctaccacctgcgccaccacattgttggtctgaattgtgggcgctgggactatatcttt
agctatataaaaacattgaaaaaccaccctaaccgcgtgttaccagatcgccagtcagtc
acgatgaataaaccttttcttagcgcgtattcccgtttgttgatcaagacatgccataaa
cgtggcgctttggcgatggggggaatggccgccttcatcccggataaagacgcagaaaag
aataagttggtgttggataaagttcgtgccgacaaagagttagaagccagtaacggccac
gatggaacttgggtggcgcatccgggcttggcagatacggtgatggacgtttttaacaaa
gtattaggttctcggcctaatcaattagaggttagccgcgaacaggataaacctatcacc
gccgctgagttgctggaaccttgttctggcgagcgcactgaagcagggatgcgggccaat
atcagagtcgcggtgcagtacattgaagcatggatatcgggtaatggttgtgtgccgatt
tatggcttgatggaggatgcggctactgcagagatttcccgcacttctatctggcaatgg
atacatcatcagaaaagcctcagtaatggccagacggtgactaaagagctgttccgcagc
atgttgagtgaagaaattcaggttgtgaagcttgagcttggcgcagagcgttttgatcgc
gggcggtttgaagaagctgcacgcttgatggagcgtattacaacacaagacgagcttatc
gacttcctgacgttgccgggctatgcattgcttgcctga

DBGET integrated database retrieval system