KEGG   Yersinia pseudotuberculosis IP32953 (serotype I): YPTB3837Help
Entry
YPTB3837          CDS       T00195                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
yps  Yersinia pseudotuberculosis IP32953 (serotype I)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:yps00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4582146..4583261)
Genome map
AA seq 371 aa AA seqDB search
MVVMFKHLASMFLLLASFSLAAASNWPAWQQFKQDYISEGGRIIDPGSPSKITTSEGQSY
GLFFALVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADI
LIAYNLLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLN
PSYLPPQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSPDWVVWQKGKGWQPDTIKPDV
GSNDAILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGSVG
FSAALLPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQ
GELQPSWHRQR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcatgtttaaacacttagccagcatgttcctgttgctggccagttttagtctc
gcagccgccagtaactggcccgcgtggcaacagttcaaacaagattacatcagtgaaggg
gggcggatcattgaccccggtagcccctcgaaaataaccacctcggaaggccagagttat
gggcttttttttgcattggttgcggatgatcagccgatgtttgagcgtttattggcttgg
acagaaaacaatctggcagccggtgatctcacttcccgccttcccgcttggttatggggg
caaaactcacaaaataactgggatattctggaccctaattcggcctccgatgcggatatc
ttgattgcctacaacttgctggaggctggcaggttatggggtaaccgccgttacctgatt
atgggtaccttattactgcaacgtattgcgcaagaagaagtcatggatattcccggcctt
ggccagatgctattaccgggaaaaattggttttaacgatgaggatacctggcgtctcaac
ccaagttatttaccgccacaactactggcacgattttcctccatagacgggccttgggaa
gcgatggtagaagtgaatcagcgtatgtggttggaaaccgcaccaaacggtttttcgccg
gactgggtggtctggcagaaaggtaaaggctggcagcccgataccataaaaccggatgtc
ggcagtaacgatgccattctggtttatctgtgggcggggatgctggcaatggacagccca
caaaaagctgaattgattgcgcgttttcagccaatggcggtaatcactcagcagcaaggc
ctgccaccgtttacgaccaacagcgacaatggtaaaactaacggggatgggtcagtgggg
ttttctgcggcattattgccctttttagccagcagcccagaaccgtttaatcagcaaaca
ctgaatctccaacagcgacgggtacaaaattcaccgcctggcgctgatgattattacagt
gctattctgaccctgtttggtcaggggtggttacagcatcgttatcattttacccatcag
ggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system