KEGG   Yersinia pestis A1122: A1122_02905Help
Entry
A1122_02905       CDS       T01831                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypt  Yersinia pestis A1122
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A1122_02905 (deoA)
Enzymes [BR:ypt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     A1122_02905 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(647160..647621)
Genome map
AA seq 153 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIVTNGAIVIHTQRLKSDPGGNLLS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggcacaagaaattatccgtaaaaaacgcgacggtcagccattgagcgaagaa
gagattcgtttttttatcaatgggatccgcgataacgttgtttctgaagggcaaattgcc
gctttagcgatgaccatttatttccacgacatgagcatgcctgagcgcgttgcgctgacc
atggcgatgcgtgattccggtactgtgctgaattggaagagcctgaatctgaatggcccg
ctggtcgataagcactccactggtggcgtgggtgatgtgacgtcactgatgcttggcccg
atggtggcagcctgcggcggctatgtgccgatgatctctggccgtggtcttggtcatacc
ggcggcacactggataaactggaggcgattgtaacgaacggtgcaatagtgatccacacc
caacgcctgaaatcagatccagggggtaatctgctctcctga

DBGET integrated database retrieval system