KEGG   Yersinia pestis A1122: A1122_04710Help
Entry
A1122_04710       CDS       T01831                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00010  Glycolysis / Gluconeogenesis
ypt00051  Fructose and mannose metabolism
ypt00562  Inositol phosphate metabolism
ypt01100  Metabolic pathways
ypt01110  Biosynthesis of secondary metabolites
ypt01120  Microbial metabolism in diverse environments
ypt01130  Biosynthesis of antibiotics
ypt01200  Carbon metabolism
ypt01230  Biosynthesis of amino acids
Module
ypt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypt_M00002  Glycolysis, core module involving three-carbon compounds
ypt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1122_04710 (tpiA)
   00051 Fructose and mannose metabolism
    A1122_04710 (tpiA)
   00562 Inositol phosphate metabolism
    A1122_04710 (tpiA)
Enzymes [BR:ypt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A1122_04710 (tpiA)
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A1122_04710 (tpiA)
  Exosomal proteins of bladder cancer cells
   A1122_04710 (tpiA)
  Exosomal proteins of melanoma cells
   A1122_04710 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEL71611
Position
1009095..1009862
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system