KEGG   Yersinia pestis A1122: A1122_05835Help
Entry
A1122_05835       CDS       T01831                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypt  Yersinia pestis A1122
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ypt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1250601..1251521
Genome map
AA seq 306 aa AA seqDB search
MVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYN
LLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLP
PQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDA
ILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAAL
LPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQP
SWHRQR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggatgatcagccgatgtttgagcgtttattggcttggacagaaaacaatctg
gcagccggtgatctcacttcccgccttcccgcttggttatgggggcaaaactcacaaaat
aactgggatattctggaccctaattcggcctccgatgcggatatcttgattgcctacaac
ttgctggaggctggcaggttatggggtaaccgccgttacctgattatgggtaccttatta
ctgcaacgtattgcgcaagaagaagtcatggatattcccggccttggccagatgctatta
ccgggaaaaattggttttaacgatgaggatacctggcgtctcaacccaagttatttaccg
ccacaactactggcacgattttcctccatagacgggccttgggaagcgatggtagaagtg
aatcagcgtatgtggctggaaaccgcaccaaacggtttttcgctggactgggtggtctgg
cagaaaggtaaaggctggcagcccgataccataaaaccggatgtcggcagtaacgatgcc
attctggtttatctgtgggcggggatgctggcaatggacagcccacaaaaagctgaattg
attgcgcgttttcagccaatggcggtaatcactcagcagcaaggcctgccaccgtttacg
accaacagcgacaatggtaaaactaacggggatggggcagtgggtttttctgcggcatta
ttgccctttttagccagcagcccagaaccgtttaatcagcaaacactgaatctccaacag
cgacgggtacaaaattcaccgcctggcgctgatgattattacagtgctattctgaccctg
tttggtcaggggtggttacagcatcgttatcattttacccatcagggagagctacagccc
tcatggcaccgtcaacgttaa

DBGET integrated database retrieval system