KEGG   Yersinia pestis A1122: A1122_06110Help
Entry
A1122_06110       CDS       T01831                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ypt  Yersinia pestis A1122
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A1122_06110
Enzymes [BR:ypt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     A1122_06110
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1122_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1325285..1327468
Genome map
AA seq 727 aa AA seqDB search
MSVLPDRQVINQLISGHYGDPFSILGMHETSQGLQICALLPDAREVWLVETENGRRIAQL
TLEDPRGFFIAQLTRRKKSFRYQFAVTWQENPQIIEDPYRFGPLLQDIDSWLLAEGTHLR
PYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRRENGIWELFLP
GIEAGQLYKFEIIDCHGQVRLKADPYAFEAQMRPETASLISPLPDVVKSSAARQKANDLC
SPVSIYEVHLGSWRRHTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPEDFKAFVAKFHQAGINVILDWVPGHFPSDEHGLSTFDGTALYEYA
DPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIYRDYSRAEG
QWVPNYYGGRENLEAIAFLRYTNKTIGVERPGSVTMAEESTDFPGVTLPPDIGGLGFNYK
WNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPLSHDEVVHGKRSILDRMP
GDAWQKFANLRAYYAFMWAHPGKKLLFMGCEFAQGREWNFETSLDWHLLDDENGWHSGVQ
RLVRDLNHCYRQYAPLYEWDYQPAGFEWLVVDDHENSVFAFLRRDAEGHELIAISNFTPV
PRYHYRVGIPQGGHYREVLNSDSAFYCGSNLGNQGGIDSHHVRSHNHEHSLLLTLPPLAT
IYLLREN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacttcccgatcgtcaggtgattaatcagcttatttccggccattatggcgac
cccttctccattttgggtatgcatgaaacctcgcaggggttgcagatttgtgcattgctg
ccagatgcccgagaagtctggctagtggagacagagaacgggcggcggatagcacaatta
acgctcgaagatccccgtggtttttttattgcacaactgactcgtcgtaagaaatccttc
cgctaccaatttgccgttacctggcaagagaacccacaaatcatcgaagatccttaccgt
ttcggtcccttattacaggatattgatagctggttattggctgaaggtacccatttacgc
ccttatgaacgtttgggggcgcatttaatgagccttgatggtgtatccggtgtcagtttt
gcggtttgggcaccgaatgctcagcgggtatccgtggtgggggattttaacttttgggat
ggccgccgccatccgatgcgcttacggcgtgaaaatggcatttgggagctatttctgcca
ggaatagaggcggggcagttgtataagtttgagatcattgattgccatggccaggtgcgt
ctgaaagctgacccttacgcttttgaagcgcagatgcggccagaaaccgcctcattgatt
agcccgctacccgatgtagtgaagagtagcgccgcacggcaaaaagccaatgatttatgt
tccccggtgtctatctatgaagtgcatctcggttcgtggcgtcggcataccgataataat
ttctggttgagttaccgcgaattggcggatcaactggtcgaatacgttaaatatatgggt
tttacccatgtcgagctgctgccgattaacgaacatccatttgacggtagctggggttat
cagccgctaggattatatgcaccgacccgccgttacggcaccccagaggatttcaaagcg
ttcgtcgccaaattccatcaggcaggaattaacgtgatccttgattgggttcccggccat
tttcccagtgatgagcatggattatcgaccttcgatggcactgcgttgtatgaatatgct
gatccgcgcgaagggtaccatcaggattggaataccctgatctataactatggccgtaac
gaagtccgtaactatctggcgggcaatgcattctactggatggaacgttttggcatcgat
gcgttgcgtattgatgcggtggcctcaatgatttaccgcgattatagccgtgctgaaggg
cagtgggtgcctaactattatggtggccgggaaaatttggaggctatcgctttcttgcgt
tacaccaataagaccattggcgttgaacgccccggcagtgtgaccatggcggaggagtca
accgactttcctggtgtgacattaccgcctgatattggtggcctgggtttcaactataaa
tggaacatgggttggatgcatgacacgctgaattatatgcaatgtgatcctgttcaccgc
aaataccaccataatttgatgacgttcggtatgttatacgcttataccgagaactttatc
ttaccgctctcccacgatgaagtggtccacggcaagcgctcgatacttgatcgtatgccg
ggtgatgcctggcagaaatttgccaacctacgggcttattacgcatttatgtgggcgcat
cccggtaaaaaactgctgtttatgggctgtgaatttgcgcaggggcgtgagtggaatttc
gaaaccagtctggattggcacctgctggacgatgaaaacggctggcattccggtgtgcag
cgtctggttcgtgaccttaaccattgctatcgccagtatgcgccgttgtatgaatgggat
tatcaacccgctggttttgaatggttggtggttgatgaccacgaaaattcggtattcgcc
ttcctgcgccgtgatgccgaggggcacgaactgattgctatcagtaatttcaccccggtt
ccacgttatcactaccgtgtgggcattccacaaggtggtcactaccgtgaagtgttgaat
tctgactctgcattttactgcggcagtaacctgggtaatcagggcggcattgatagccat
catgtgaggagccacaaccacgagcattcgttgttactcaccttgccaccgctggcaacg
atttacctgctgcgggagaactag

DBGET integrated database retrieval system