KEGG   Yersinia pestis A1122: A1122_06670Help
Entry
A1122_06670       CDS       T01831                                 

Definition
phospholipase A (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ypt  Yersinia pestis A1122
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A1122_06670
   00565 Ether lipid metabolism
    A1122_06670
   00590 Arachidonic acid metabolism
    A1122_06670
   00591 Linoleic acid metabolism
    A1122_06670
   00592 alpha-Linolenic acid metabolism
    A1122_06670
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     A1122_06670
    3.1.1.32  phospholipase A1
     A1122_06670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1458394..1459272
Genome map
AA seq 292 aa AA seqDB search
MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQDHDNPFLLYPYETNYL
LYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGDNSLLGASYTQRSWWQA
SNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQSNGKADPTSRSWNRVYT
RVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKVGYALGDSVFSLDGRYNWN
TGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattttggcagatactgattgcgttattactggtgccaacattggcacaggct
gaagaagcaacgattgaaaagattcatgatgcgcccgcagtgcgtggcagtattatcgcg
gcaatgttgcaggaccacgataatcctttcctactttatccgtatgaaaccaactatttg
ctctacacctataccaacgagatcaataaacaagccattagctcgtatgattgggctgaa
caggcgaataaagatgaagtaaaattccaactgagtttagctttccctatctggcgtggt
attgccggggataactcattattgggggcttcttatacccagcgttcatggtggcaggca
tccaacagtgaagaatcttcaccttttcgtgaaaccaactacgagccacagctgtttttg
gcgtggtcaacagattacgaattggctggctggactttccgcgaagtcgaatttggtttt
aaccatcaatccaacggtaaagctgacccaacctcacgtagttggaaccgtgtttatacc
cgcgtgatggcacaacgtggcaatttggaaatcgacctgaagccttggtatcgtattcct
gaaagcgacagtaaagatgataaccctgatattacgaaatacatggggtattatcgcctg
aaagtcggctatgccctgggtgacagcgtattcagccttgatggtcgctataactggaat
accggttacggtggcgcggaaatgggctggagctacccaattaccaaacatgttcgcttc
tatactcaggtattcagtggctacggtgagtcaatgattgactataactttaggcaaaca
cgggtgggtgtaggtatcatgttgaacgatgtcctttaa

DBGET integrated database retrieval system