KEGG   Yersinia pestis A1122: A1122_06990Help
Entry
A1122_06990       CDS       T01831                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ypt  Yersinia pestis A1122
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A1122_06990
Enzymes [BR:ypt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A1122_06990
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1122_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1525385..1526407
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGTFPGRRMRRVRCHDFSRRLVAENHLTVNDLIYPVFVMEGTHQQQAVSSMPGVS
RMTIDLLLKEAEAIAKLGVPVISLFPVIEAGKKSLYAEEAYNPDGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDSDGYVINDVTKEILVRQALSHAEAGAEIIAPSDMMDGR
IGAIRDQLERQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSNLKGGDKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggcacctttcctggtcgccgtatgcgccgtgtacgctgtcat
gatttcagccgccgtttggttgccgagaatcacttgacggtcaatgacttgatttacccg
gtgtttgtcatggaagggactcaccagcaacaagccgtttcttcaatgccgggggtctct
cgtatgacaattgatctgctgctgaaagaagcagaagcaattgctaagctcggtgtgccg
gttatatcgctattcccggtcattgaagcagggaaaaaatcattatatgcagaagaggca
tataacccggatggtttagttcagcgtactgtgcgtgcgttgaaagatgcagttcctgag
ctaggtattctgactgacgtggcactcgatccctatacgacccatggtcaagatggtgtg
attgattctgatggttacgtgatcaatgatgtcaccaaagagattctagtgcgtcaggca
ctatcgcatgctgaagctggcgctgagattattgcaccaagcgatatgatggatggccgt
ataggtgcaattcgtgatcaattagagcgccaagggttagtgaacacccagataatggct
tattcggctaagtatgcgtcttgctactatggcccattccgcgatgcaattggctcgagc
agtaatctaaaagggggggataaaaaaacttatcagatggatcccgccaacagtgatgaa
gcactgcaagaaatagctcaagatttacaagaaggcgctgatatggtgatggtaaaacca
ggaatgccatatctggatgttgtacgcagggtgaaagatacttttggtgttccaaccttt
gcctatcaggtgtctggtgaatatgccatgcatatggcagcgattcagaatggctggctc
caagagaaaccgacggtgatggagtcgttgttatgctttaagcgtgcaggtgcggatggc
gtattaacttatttcgcaaagcaagttgcgcaatggctacatgatgaccagatgcagcgc
taa

DBGET integrated database retrieval system