KEGG   Yersinia pestis A1122: A1122_08250Help
Entry
A1122_08250       CDS       T01831                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ypt  Yersinia pestis A1122
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A1122_08250
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     A1122_08250
Transfer RNA biogenesis [BR:ypt03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    A1122_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817803..1818543
Genome map
AA seq 246 aa AA seqDB search
MLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAHQIIKAGLARLTPDIP
LLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDQGEPVLGVVYVPVT
EVMYSAANGQAWKEECGRRMQIQVRDAQPPLVVVSRSHSDAELEDYLSQLGEHQTISVGS
SLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKTLSYTPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaattggccagttggcccgtgaggcaggcgtggcgattatggcggtctat
cagggcgacaaaccccttgatattgcgcataaaaaggatgattcaccggtgacggcggct
gatttggcggctcaccagattatcaaagctgggttggcgcgattaaccccggatattccg
ctactctctgaagaggatccacccgcttgggatgtgcgccagcactggcaacgctactgg
ctggttgacccgctggacggtactaaagagttcctcaatcgtaacggtgaattcaccgtc
aacatcgctttgattgaccaaggtgaaccggtactgggcgtcgtctatgtaccggtaacc
gaagtgatgtacagcgcggcaaacggacaggcttggaaagaagagtgtggcagacgtatg
cagattcaggtgcgtgatgcccagcctccgttggtcgtggtgagccgctctcacagcgat
gctgaattggaagactatttatcacaactgggggagcatcaaactatttcggtgggctca
tcacttaaattctgcttggtggcggaagggaaagcgcaactgtacccgcgttttgggcca
actaacgtctgggatacggcggctggtcatgccgtcgccatcgctgccggggcgcaagta
cacgattggcagggaaagacactgtcttataccccacgtgaatctttcttgaaccccggt
ttcagagtttcgttattttag

DBGET integrated database retrieval system