KEGG   Yersinia pestis A1122: A1122_08250Help
Entry
A1122_08250       CDS       T01831                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ypt  Yersinia pestis A1122
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ypt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817803..1818543
Genome map
AA seq 246 aa AA seqDB search
MLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAHQIIKAGLARLTPDIP
LLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDQGEPVLGVVYVPVT
EVMYSAANGQAWKEECGRRMQIQVRDAQPPLVVVSRSHSDAELEDYLSQLGEHQTISVGS
SLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKTLSYTPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaattggccagttggcccgtgaggcaggcgtggcgattatggcggtctat
cagggcgacaaaccccttgatattgcgcataaaaaggatgattcaccggtgacggcggct
gatttggcggctcaccagattatcaaagctgggttggcgcgattaaccccggatattccg
ctactctctgaagaggatccacccgcttgggatgtgcgccagcactggcaacgctactgg
ctggttgacccgctggacggtactaaagagttcctcaatcgtaacggtgaattcaccgtc
aacatcgctttgattgaccaaggtgaaccggtactgggcgtcgtctatgtaccggtaacc
gaagtgatgtacagcgcggcaaacggacaggcttggaaagaagagtgtggcagacgtatg
cagattcaggtgcgtgatgcccagcctccgttggtcgtggtgagccgctctcacagcgat
gctgaattggaagactatttatcacaactgggggagcatcaaactatttcggtgggctca
tcacttaaattctgcttggtggcggaagggaaagcgcaactgtacccgcgttttgggcca
actaacgtctgggatacggcggctggtcatgccgtcgccatcgctgccggggcgcaagta
cacgattggcagggaaagacactgtcttataccccacgtgaatctttcttgaaccccggt
ttcagagtttcgttattttag

DBGET integrated database retrieval system