KEGG   Yersinia pestis A1122: A1122_09375Help
Entry
A1122_09375       CDS       T01831                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypt  Yersinia pestis A1122
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A1122_09375
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A1122_09375
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1122_09375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2064454..2065941
Genome map
AA seq 495 aa AA seqDB search
MSTPIILAIDEGTTNAKAIAVDRAGRVLAKASVPLQLEHPQPGWAEQDPLAIWLAVSQAV
EGCLNQLAGAQVAGIAISNQRESVLIWERETGTPLTPVVSWQCRRSEAFCLALRQLPAAA
MVAERTGLQIDPLFPAAKIHGMLAQIPHGAERAAHGELCVGTLDCWLTWQFSEGQSFSTD
FSNAARTQLFNIHSGQWDPDLLALFGIPSLCLPAVLPSASIHGHTARTGILGLEQGVPIV
AHIGDSHAALYGQGGDQAGEIKATYGTGSSLMMTLKQASAPSHGLSTTIAWHDGELRYAL
EGNITHTGSGVAWVSRMLGISDLSRLTDMAESQSGNQGVYFVPALSGLGAPYWDSQARGL
FCGLTDATTPAVLARAALESVAYQIADVFFAMENAAHHRLERLRVDGGATSNRWLMQFQA
DLLQRTLIRNHTAEVSALGAAYLGGKTLGWWQDSQQLAALPREVEYIEPRIHSAEMQDNY
SLWQTAIARARFQPK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgccaatcattctggctattgatgaagggacaaccaacgccaaagccattgcg
gtagatcgtgccgggcgagttctggcgaaagcctcggtaccattacaactggagcatcct
cagcccggttgggcagaacaggatccgctggcgatttggctggcggtttctcaggcggtt
gaggggtgcctaaatcaattggcgggcgcacaggtggcggggattgccatcagtaatcag
cgtgaatcggtactgatttgggaacgggaaaccggcacgccgctcacgccagtcgtaagc
tggcagtgccgtcgttcagaggctttctgtctggctttgcgccaattaccggctgcggcg
atggttgcggaacggactggattgcagattgatcccctgtttcctgcggctaaaattcat
ggcatgttggcgcagatccctcatggcgctgaacgtgccgctcacggtgagctgtgtgtt
ggcacgcttgattgctggctgacctggcagtttagcgaagggcaaagtttctcgactgac
ttctctaatgcggcccggacccagctgtttaatatccattcaggtcaatgggaccccgat
ttactggcgctgtttggtatcccaagtctttgcctgcccgccgtcttaccctcggcatcc
atccacggacacaccgcgcgcaccgggattctcggcctggagcagggcgtgcctatcgtg
gcacacattggtgattcgcacgccgcgctgtacgggcaaggcggcgaccaggccggtgaa
atcaaagccacttatggcaccggctcctctctgatgatgacgctaaaacaggccagtgca
ccaagccacggcctaagcaccaccattgcctggcatgacggcgaattacgttatgccctt
gaaggtaacatcacccataccggctcaggagtggcatgggtctcgcgcatgttagggatc
agtgatttgtcacgtctgactgacatggcagaaagccaatcaggtaatcaaggcgtctat
tttgtaccggcattatcaggactgggtgcgccttattgggacagtcaggcgcgtggtttg
ttctgtggtctgacggatgccacgacaccggccgtactggcgcgagcggcacttgaatca
gtcgcttatcaaatagccgatgttttctttgcgatggagaatgcggctcatcatcgcctt
gaacggctgcgggttgatggcggcgcgaccagtaatcgctggctgatgcagtttcaggcc
gatttattgcagcgcacattgatacgtaatcacacggcagaagtgtcagcactgggtgcc
gcgtatttgggcgggaaaacccttggctggtggcaggatagccaacaactggctgcgctc
ccccgtgaagtggaatacatcgaaccgcgcattcacagtgcggagatgcaagataactat
agcctctggcaaacggccatcgcgcgtgcgcgttttcagccgaaataa

DBGET integrated database retrieval system