KEGG   Yersinia pestis A1122: A1122_10360Help
Entry
A1122_10360       CDS       T01831                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ypt  Yersinia pestis A1122
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1122_10360 (recR)
DNA repair and recombination proteins [BR:ypt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      A1122_10360 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2283404..2284009
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEHCTICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccactcctggagtcattaatggaggcgttgcgttgtttaccgggtgtt
ggcccgaaatcggcgcaacgtatggcatttcagctattacagcgcgatcgtagtggtgga
atgcgcctggcgcaggctctgacacgggcaatgtctgaaataggccattgtgcagattgt
cgtacatttaccgagcaagagcactgcaccatctgcttgaatccccgccgtcaacaaaat
ggtcaaatctgtgtggtcgaaagcccggcagatatccatgccattgagcaaactggccag
tttggcgggcgttattttgtgctgatggggcatttatcacctatggatggtattggccct
ggtgatatagggctagatctactggagaaacggctttctactgaggctatcagtgaggtc
attttagccacgaatccaaccgttgaaggggatgcaacagccaactatatcggccagatg
tgtggccaatatggcatactggccagccgcatcgcccatggcgttcctgttggtggcgag
ttagaaatggttgatggcaccacgttatctcactcgttagcagggcgtaatcccatcaag
tactga

DBGET integrated database retrieval system