KEGG   Yersinia pestis A1122: A1122_12930Help
Entry
A1122_12930       CDS       T01831                                 

Definition
glycoside hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ypt  Yersinia pestis A1122
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A1122_12930
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A1122_12930
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A1122_12930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2799292..2801355)
Genome map
AA seq 687 aa AA seqDB search
MKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALELSALPKPASDAIQQRFELLGLALS
ATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEVIGFDQVGVFYGLQSILSLVPIEGS
KTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRLLDQMSAYKLNKFHFHLSDDEGWRI
EIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESNNLGSGYFTRADYIDILKYAKARQI
DVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEANEFRLVDPTDDSNTTSVQFYERKSY
LNPCLDSSKHFVDKVIGEMAKMHKEAGMPLTTWHFGGDEAKNIRLGAGYQDKNGKIEPGK
GIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSYFAIEVSKLVNAHGIEKMQAWQDGL
RDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANKGYEVIASNPDYVYFDMPYEVNPSE
RGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGNHFSAKSDKPWPGVQGISGQSWNET
VRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGREYKGGETQWVDTQALSTDWQRFAN
IMGQRELAKLDKAGVAYRLPVPGARVVAGQLEANISLPGLLIEYSTDGGKKWQQYDAKAQ
PTVSGEVMIRSTSPDGKRSSRAEPVNI
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacactctctgcggctaacctgcgtgggcagattatcccaacaccactggacgtt
aaggtttatccgcaagatgccgatctgagcctcggtgtggcgctggaattgagtgcgcta
cccaaaccggcctctgatgccatacagcaacgttttgaattgctgggcctggcgctaagc
gcgacgggctatccgattaaaacagtgattcagccaacggccttcaacggggatcacgct
gtttccggtgcgtatgaactgaaaattggtgagaagggcgcagaggtgattggttttgat
caggtcggtgtattctatggcctgcaatctatcctttccttggtacctattgaggggagc
aaaacaatagccacccttgatgcgaaagatgcgccacgctttgactaccgtggtgtctcg
ctcgatgtggggcgtaacttcaaaaccaaagcggcggtcctacgtttattggatcaaatg
tctgcttacaaactgaataaattccacttccatctgagtgatgatgaaggctggcgcatt
gagatccctggcctgcctgaattgaccgatgtcggcagccagcgttgccatgatttgact
gaaaccacctgtttgctaccacagctaggctctggccctgagagcaataatctggggagc
ggttatttcactcgcgctgattacatcgatattctgaaatatgccaaagcgcgccagatt
gatgtcattcctgagatagatatcccggctcacgcccgtgctgctgtggtatcgatggaa
gcgcgttataacaatttgatgaaacagggtaaagagaaagaagccaatgaattccgtctg
gttgatccgaccgatgactcgaataccacatcagtacagttctatgagcgtaaaagttac
ctgaatccctgcctggactcttctaagcattttgtcgacaaagtcattggtgaaatggcg
aagatgcacaaagaggccggtatgccgctgaccacctggcatttcgggggcgatgaggcg
aagaacatccgtctgggggcgggttatcaggataagaatggcaaaattgagccaggtaaa
ggcatcatcgatatgcgcgttgaagataaaccgtgggcgaaatctcaggtttgtcaggac
atggtcaagcaaggcaaagttcaagatattgctcatctttccagctacttcgccattgaa
gtcagcaaactggttaatgcgcacggtatcgaaaaaatgcaggcctggcaggatggactg
agagatgccaaagatgcgagcgcgtttgctaccaagcgtgttggcgtcaacttctgggat
accctctactggggcggagcggactccgtcaacgattgggccaataaaggttatgaagtc
attgcctcgaatccagattatgtctacttcgatatgccgtatgaagttaacccaagtgaa
cgcggttactactgggcgacgcgctttagcgatgaagccaaggtgttcagcttcgcacct
gacaacatgccacagaacgccgaaacctcggttgatcgcgatggtaatcatttcagtgcg
aagagtgataaaccctggccgggtgtacagggtatctccggtcagtcttggaatgaaacg
gtacggactgatgagcagatggagtacatggccttccctcgtgtattaccgctggctgag
cgtgcatggcatcgcgcatcctgggagcaggagtataaagcggggcgtgaatataaaggt
ggcgagactcagtgggtcgatactcaggcattaagcacggattggcagcgtttcgctaac
attatggggcaacgtgaactggcaaaactggataaagcgggtgtggcttaccgcttgcca
gtaccgggggccagagtggtggcggggcagttggaagccaatatttccttgccaggcctc
cttatcgagtactccactgatggaggcaaaaaatggcagcagtatgatgctaaagcgcaa
cctactgtcagcggtgaagtgatgatccgttccaccagcccagacggtaagcgcagtagc
cgtgcggagccagttaacatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system