KEGG   Yersinia pestis A1122: A1122_14650Help
Entry
A1122_14650       CDS       T01831                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ypt  Yersinia pestis A1122
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1122_14650
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A1122_14650
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A1122_14650
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A1122_14650
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1122_14650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3176799..3178244
Genome map
AA seq 481 aa AA seqDB search
MNRVPTLSGIALSSGIALSTLLLSSALLTPNAIAAATGLYDRAAHGDVTQFGGARRLTED
QTQALRDSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYA
LDKKTQKPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVST
AELQDATPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIEGRADVTLGGGA
ASFSQVAKAGEWKDQSLRDQALARGYVIVENLDDLNAIKHANQQKPLLGLFSPGNMPVRW
QGPKASYHGNLDKPPVVCENNAERTSDIPTLAVMTEKAIDLLKTNENGFFLQVEGASIDK
QDHSANPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEPEAKAPGLTQ
ALTTKDGAVMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAL
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgtacctactttatccggcatagcattatcatccggcatagcattatcgact
ctgttactgtccagtgcgctattaacgcctaatgcgattgcggctgctacgggcttatat
gaccgtgctgcgcatggtgatgtgactcaatttggcggcgcacgtcgtttgactgaagac
caaacccaggctctgcgtgactcgttatccaataaaacagtaaaaaatgtcattttgttg
attggagatgggatgggcgattctgaaatcacgtctgcccgtaactatgcgatgggggcc
ggtggtttctttaaaggcattgatgcgctgccgctgaccgggcaatacacgcactatgca
ctcgataaaaaaacacaaaaaccaaattatgtgactgattctgctgcatcagcgacggcc
tggtcatctggcgtaaaaacgtataatggtgcgttgggggttgatgtttttggtaaagac
catgttacgttgctggaactggccaaaaaagcaggcaaagcgacgggtaatgtctctacc
gctgaactacaagatgccactcctgctgcgcagtttgcccacgtgaccgggcgtaagtgc
tatggcccggaagaaaccagtgagaaatgcagtaccaatgcattggaaaaagggggccgt
ggctctattactgagcaaatgattgaagggcgcgctgatgtcacgcttggcggtggtgca
gcatcattcagccaggtcgctaaagccggtgagtggaaagaccagtcgttgcgtgatcag
gcgttggcccgcggctacgtcattgttgagaaccttgatgacctgaacgcaataaaacac
gctaatcaacagaaacctctattgggcttattctcgccaggtaatatgccagtgcgttgg
caggggccaaaagcctcttatcatggcaatctggataaaccgccagtggtgtgtgaaaac
aatgctgagcggaccagcgacattccaacgttggctgtcatgacagaaaaagccattgac
ctgctgaaaaccaatgagaatggcttcttcttgcaagttgaaggggcgtcgattgataaa
caggatcactccgctaacccatgtggtcagtttggtgaaacggttgatctggatgaagcg
gtacaaaaagcgctggaattcgcccgtgctgatggcaacactttggtgattgtgacggct
gaccatgctcactccagccaaattatcgagcctgaagcgaaggctccgggcctgactcag
gcattaacgaccaaagatggcgcggtcatggcgatcagctacggtaactctgaagacgat
tctcaaggccatactgggtcacaattgcggatagcggcttatggtcctcacgcggctaac
gtcgtaggtttaactgaccaaactgatttgttcttcaccatgcgggatgcgatggcactt
aaataa

DBGET integrated database retrieval system