KEGG   Yersinia pestis A1122: A1122_15120Help
Entry
A1122_15120       CDS       T01831                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ypt  Yersinia pestis A1122
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1122_15120
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A1122_15120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1122_15120
Enzymes [BR:ypt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A1122_15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3282981..3284171
Genome map
AA seq 396 aa AA seqDB search
MTTLNPYFGEFGGMYVPQILVPALKQLEDAFVSAQLDPEFQAAFQDLLKNYAGRPTALTL
CQNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGTY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEGRLPDAVLACVGGGSNAIGMF
ADFIDEPDVGLIGVEPAGLGIETGQHGAPLKHGKVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALDAFKTLSCKEGIIPALESSHALAHALKM
IKADPDKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacttaatccctattttggcgaatttggcggtatgtatgtgccccaaatttta
gtgccagccctgaagcaactggaagacgcattcgtcagtgctcaactggatcctgaattt
caggccgcatttcaagatttgttaaaaaactatgccggtcgccctaccgccctgaccttg
tgtcaaaatctgaccaaagggacaaagaccaagctatatctgaaacgtgaagatctgctg
cacggcggtgcacacaaaaccaaccaggttttaggtcaggctttattagctaaacgcatg
ggtaaaactgaaattattgccgaaaccggtgccggccagcacggggttgcctccgcactg
gcttgtgcattgctgggtttaaaatgccgcatttatatgggggcgaaagatattgaacgt
cagtcgcctaacgttttccgtatgcgcctgatgggagccgaggttattccagtgcatagt
ggttcatcgacgctgaaagatgcctgtaatgaagcgctacgtgactggtcaggtacttat
gaaaccgctcactatatgctgggtaccgccgctggccctcacccttacccgacaattgtg
cgcgaattccaacgcatgatcggtgaagaaaccaaggctcagatactggaaaaagaaggc
cgcctgcccgatgcagtattggcctgtgttggtggcggttctaatgctatcggtatgttt
gctgattttattgatgagcctgatgtgggtctgattggcgtagagcctgccggcttgggg
atcgaaaccgggcaacatggtgcccccctaaaacacggtaaggtcggtatctacttcggt
atgaaatcaccgatgatgcagaccagcgatgggcaaattgaagaatcttactctatttct
gccggtctggacttcccctctgtggggccgcaacatgcttatttgaacagtattgggcgg
gctgattatgtctccattaccgatgatgaggctttagacgcatttaagacattgtcatgt
aaagaagggattattccagcgctagagtcctctcatgctctggcacatgcgttgaaaatg
attaaagcggatccggataaagaacaaatactggtggtgaatctctccggccggggtgac
aaagatattttcaccgttcacgatattctgaaagcacggggagagatttaa

DBGET integrated database retrieval system