KEGG   Yersinia pestis A1122: A1122_15125Help
Entry
A1122_15125       CDS       T01831                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ypt  Yersinia pestis A1122
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1122_15125 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A1122_15125 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1122_15125 (trpA)
Enzymes [BR:ypt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A1122_15125 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3284171..3284977
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPSPAMSLNIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEILAEIRQKHPTIPIGLLMYANLVFHNGIDHFYQRCAE
VGVDSVLIADVPFEESAPFRAAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLVDKLREYNAAPALQGFGISEPAQVKASLAAGAAGAISGSAIVKI
IEKNVAQPVEMLVQLTRFVTEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcaactttttaagcagttagccgccaaaaaagaaggtgcctttgtt
cctttcgtccagcttggcgatccctctccggcgatgtcactcaatattattgatacgtta
attgcggcaggtgcagatgcattagagttagggattccgttctctgatccgttggctgat
ggccctaccatacaaaatgcggcgctgcgtgcctttgctgcgggtgtcactccgggtatt
tgttttgaaatactggccgaaatccgccaaaaacaccccacaatacctattggcctgttg
atgtatgcaaatctggtattccacaatggtattgatcacttctaccagcgctgtgctgag
gtgggtgtcgattcggtgctaattgctgatgtgccatttgaagagtctgcccctttccgg
gcagcggccttacgtcacgggattgcacccattttcatctgcccgcctaatgccgacgat
gacttactgcgagaaatcgcttctcatggtcgtggttatacttacctgttatcacgtgcc
ggagtcaccggtgcagaaaatcacggccagttaccgttaaaccatctggtagataaactg
cgtgaatataatgcagcgcccgcattgcagggctttggtatttcagaacccgcgcaagta
aaagccagcctggcggcgggcgcggcgggtgctatttcaggctcagcaatcgtcaaaatc
attgaaaaaaatgttgcacaacccgttgaaatgttagttcagctaacccgcttcgtcaca
gagatgaaagcggcaacccgcagctag

DBGET integrated database retrieval system