KEGG   Yersinia pestis A1122: A1122_15280Help
Entry
A1122_15280       CDS       T01831                                 

Definition
(GenBank) putative nucleotide sugar dehydrogenase
  KO
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
ypt  Yersinia pestis A1122
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A1122_15280
   00053 Ascorbate and aldarate metabolism
    A1122_15280
   00520 Amino sugar and nucleotide sugar metabolism
    A1122_15280
Enzymes [BR:ypt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     A1122_15280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3314683..3316029)
Genome map
AA seq 448 aa AA seqDB search
MKVTVFGIGYVGLVQATVLAEVGHDVLCIDIDANKVADLKKGRIAIFEPGLAPLVKENYE
AGRLQFSTDAQAGVAHGVIQFIAVGTPPDEDGAADLKYVLDVASTIGTYMDSPKVIIDKS
TVPVGTADKVHQVIQAILEQRGEKIDFSVVSNPEFLKEGAAVADCKRPERIVIGIDTDDS
GALELISELYEPFNRNHDRMLVMDIRSAELTKYAANGMLATKISFMNEIANIAERLGADI
EKVRQGIGSDSRIGYHFIYSGCGYGGSCFPKDIQALIRTAEDKGYKPQLLQAVEQINNQQ
KYKLTEFIKSHFNSQLAGKTFAVWGLAFKPNTDDMREAPSRVVMESLWEAGATIQAYDPE
AMDETQRIYGARDDLRLMGTKESALQGADALIICTEWQSFRAPDFDMIKSRLKHPVIFDG
RNLYDPERLNSRGFTYYGIGRGVSINLS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttacggtttttggtattggttatgtgggacttgttcaagctacagtgcttgcc
gaggtggggcatgatgtcctttgtatcgatattgatgctaataaagttgccgatttgaaa
aaaggccgtattgctatttttgagccgggcttggctccgttggtcaaagaaaactatgag
gcaggcagattacagttttcaacagatgcgcaagctggtgtggcacatggcgtcattcaa
tttattgctgtgggtacacctcctgatgaagacggtgctgccgatcttaaatatgtcctt
gatgtggccagtaccattggcacgtatatggactcacctaaggtcattatcgataaatct
acagtgcccgtggggacagcggataaagtacatcaagttatacaagctattttggagcag
cgcggtgagaagatagattttagtgtggtatcaaatcctgagtttttaaaagagggggcc
gcagttgctgattgtaaacggcctgaacgtattgttattggtattgatacggatgacagt
ggtgctctagagttaatcagtgaattatacgaaccttttaatcgaaatcatgatcgtatg
ctagtaatggatatccgtagtgcagaactgacaaagtatgctgcaaacggcatgctggca
acgaaaataagtttcatgaatgagattgctaatattgctgagcgattaggggctgatatc
gaaaaagttcgacagggcatcggttccgattcacgtattggataccatttcatttattct
ggttgtggttatggggggtcttgtttcccaaaagacatccaagcattaattcgtactgca
gaagataagggttataagccccagctattgcaggctgtcgagcaaatcaataatcagcag
aagtataagttaactgaattcattaaaagtcattttaattcgcagttagctggaaaaaca
tttgctgtctggggattggcctttaagcccaacaccgatgatatgcgtgaggcaccgagc
cgtgtggtaatggaatcattgtgggaagccggggctacaattcaagcatacgatcccgaa
gcaatggatgagacgcaacgcatttatggtgcaagagatgatttgagattaatggggact
aaagagtctgcattacagggagctgatgccttgattatttgtactgaatggcaaagtttt
cgtgctccagattttgatatgatcaagtcaaggttaaagcaccctgttatttttgatggg
cgtaatttgtacgatccagaacgcctaaatagtcgtgggttcacttattatggaattggg
cgtggtgtttcgattaatctatcatag

DBGET integrated database retrieval system