KEGG   Yersinia pestis A1122: A1122_15285Help
Entry
A1122_15285       CDS       T01831                                 

Definition
(GenBank) response regulator of RpoS
  KO
K02485  
two-component system, response regulator
Organism
ypt  Yersinia pestis A1122
Brite
Two-component system [BR:ypt02022]
 Other families
  Unclassified
   A1122_15285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3316336..3317352)
Genome map
AA seq 338 aa AA seqDB search
MEKPLAGKNILVVEDEVVFRTVLAEYLGSLGATIHQAENGLAALYQLKGHSPDLILCDLA
MPKMGGIEFVEQLLLKGIKIPVLVISATDKMADIAQVLRLGVKDVLLKPIVDLNRLREAV
LACLYPTLFTSHAIEETELIQDWEALRKNPSGALQLLKQLQPPAQQTLAHCRINYRQLTM
VEKPGLVLDIAALSDKDLAFYCLDVTRAGDNGVLAALLLRVLFNGILQEHLTHQQQRLPQ
MSSLLKQVNLLLRRTHLDGQFPLLVGYYHVEYQNLILVSAGLHANISAGKNQIQLNNGVP
LGTLKTAHLNQVSQRCEAWQCQVWGGGSRLRLMLAAEE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaccactagcaggtaaaaatattttagttgtcgaggatgaagtcgtattccgt
accgtcttggcggaatacctcggctcacttggcgcgacaatccatcaggccgaaaatggg
ctggcggctttatatcagctaaaaggtcactctcctgacttgatcctttgcgatctggct
atgccgaagatgggggggattgagtttgttgagcagttactactgaaagggataaagatc
cctgtattagtgatctctgcaactgacaagatggcggatattgctcaggtattacgctta
ggcgtaaaagatgtgctattgaaacctatcgtggatttgaatcgtttacgtgaagctgta
ttggcctgcttgtatcccacattatttacttcccatgctattgaggaaacagagctcatt
caggattgggaggctttacgcaaaaatccaagtggtgccctacaattgttaaaacagtta
cagcctccagcgcaacaaacccttgctcattgtcggataaattatcgccagcttaccatg
gtagaaaaaccagggttggtactcgatattgcagcgttatccgataaggatttagctttc
tattgtttggatgtcacccgtgcgggtgataatggggttttagccgcattattattacgt
gtactatttaatggcatcttacaagagcatttaacacaccaacagcaacgtttaccacag
atgtcatctttacttaagcaggtcaatctactattaagacgtacgcaccttgatggacag
tttcctttattagttggttattaccatgttgagtatcagaatttaattttggtttcagcc
ggtttgcatgcaaatatcagcgcgggtaaaaaccagattcagcttaacaatggtgtccct
ttagggaccttaaaaacagcacacttaaaccaggtcagtcagcgctgtgaagcatggcag
tgtcaggtatggggcggagggagccgtttaaggctgatgcttgctgctgaagaatag

DBGET integrated database retrieval system