KEGG   Yersinia pestis A1122: A1122_15295Help
Entry
A1122_15295       CDS       T01831                                 

Gene name
purU
Definition
(GenBank) formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00630  Glyoxylate and dicarboxylate metabolism
ypt00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A1122_15295 (purU)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A1122_15295 (purU)
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     A1122_15295 (purU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT
Motif
Other DBs
NCBI-ProteinID: AEL73683
Position
3319234..3320103
Genome map
AA seq 289 aa AA seqDB search
MPHQNVQKKVLRTICPDAKGLIAKITNICYKHQLNIVQNNEFVDHLTGRFFMRTELEGIF
NDTTLLADLDDALPEGTNRELHVAGRRRIIIMVTKEAHCLGDLLMKSAYGGLDVEIAAVI
GNHDALQNLVERFDIPFHLVSHEGLTREQHDQQLIEKIEQYQPDYVVLAKYMRVLTPAFV
QRFPYQIINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDSLDEGPIIMQDVINVD
HSYTAEDMMRAGRDVEKNVLSSALYRSLSIILCNCHRIKGDRSGGHRTR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccacaccagaatgtacaaaagaaagtattgcgcactatttgccctgacgctaaaggt
ttgatcgcaaagatcactaatatctgctacaagcaccaattgaatatcgtacaaaataat
gaatttgttgatcacctgactggtcgcttctttatgcgcaccgagcttgaggggattttt
aacgatacgacattactggcagatcttgacgatgcattacctgaaggcactaatcgcgag
ttacacgttgctgggcgccgccgcatcatcattatggtaacgaaagaagcacattgcctt
ggcgacttattaatgaagagtgcttatggtggcttagatgtagaaattgcggcagtcatt
ggtaaccatgatgcattgcaaaatttagtcgagcgttttgatatcccattccatctggtc
agccatgaaggcctcacccgtgagcagcatgatcaacagttgattgagaaaattgaacaa
tatcaaccagattatgttgttctggctaaatatatgcgggtgctaacaccggcctttgtg
caacgtttcccttatcaaattattaatattcatcattcatttttgcctgcatttatcggt
gctcggccataccaccaagcgtatgaacgcggagtgaagattattggcgctactgctcat
tacgtaaatgatagcttggatgaaggcccaatcatcatgcaggacgtgatcaatgtggat
cattcttatactgctgaagatatgatgcgtgctggtcgtgatgtagaaaagaatgttctc
agtagtgcgctataccggagcctgtccataattctgtgtaactgccaccgtattaaaggt
gatcgctcaggcggtcaccgaactcgataa

DBGET integrated database retrieval system