KEGG   Yersinia pestis A1122: A1122_15355Help
Entry
A1122_15355       CDS       T01831                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ypt  Yersinia pestis A1122
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A1122_15355
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     A1122_15355
    3.5.1.-  
     A1122_15355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3332203..3332850
Genome map
AA seq 215 aa AA seqDB search
MKAALLLIDLQNDFCPGGALAVSEGDEVISVANRMIEACLAKNIPVIASQDWHPIEHRSF
AVNAKAEPGTVGELEGLVQVWWPVHCVQEQPGAALHPQLKQGAITAIFRKGQNPDIDSYS
TFFDNGRRAKTALDSWLQQHSIDHLYVMGLATDYCVKYSVLDALALGYQTTVISDGCRGV
NLQPQDSQLAFDAMSDAGANLLALEQCLAEVVSAD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccttgctcttaatcgatttacaaaacgacttttgtcctggtggagcgttg
gctgttagtgaaggtgatgaggtcattagcgtggctaaccgcatgattgaagcctgtctc
gcaaaaaacataccggtgattgccagccaagattggcacccaattgagcaccgtagcttt
gcggtgaacgccaaggcggagccgggcacagttggggaactagaagggttagtacaagta
tggtggccggtacattgtgttcaggaacaaccaggggcagcattgcacccacagctgaaa
caaggcgctattacagctatttttcgcaaagggcaaaaccctgatatcgacagttacagc
actttcttcgacaatggccggcgagctaaaacagcattagatagctggctacaacagcat
agcattgaccacctgtatgttatggggctggccacagattactgtgtgaaatatagcgta
ctggatgcactcgctttgggttatcaaaccacggttatcagtgatgggtgtcgtggggta
aacttgcaaccacaagacagccaactggctttcgatgcaatgagcgatgcaggcgccaac
ttactggctcttgaacaatgcctggctgaagtcgtttcagccgactga

DBGET integrated database retrieval system