KEGG   Yersinia pestis A1122: A1122_15365Help
Entry
A1122_15365       CDS       T01831                                 

Definition
(GenBank) methionine sulfoxide reductase B
  KO
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
ypt  Yersinia pestis A1122
Brite
Enzymes [BR:ypt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     A1122_15365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3333327..3333740)
Genome map
AA seq 137 aa AA seqDB search
MAKELNPTENIEKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKF
DSGCGWPSFYQPIDADSIRYIDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERYCIN
SASLNFVDDQNGEQTAG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaactgaaccctacagaaaatattgagaaactgtccgatattcagcggtat
gtcacccaagaacgtggaacggaagcccccttcacgggcaaattgttgcacaataagcgt
gatggggtgtaccaatgtctgtgttgtcaccagccgctctttatctctgaatcaaagttt
gattctggctgtggttggccaagcttctatcaacccattgacgctgattcaatacgctat
attgatgattattctcataatatgcatcgtatcgaaattcgttgtggtaattgtgatgcc
catttggggcatgtattccccgacggaccgcagcctacgggtgaacgttattgcataaat
tcggcgtcactgaatttcgttgatgaccaaaatggtgagcaaactgcaggctga

DBGET integrated database retrieval system