KEGG   Yersinia pestis A1122: A1122_15395Help
Entry
A1122_15395       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA PUNUT TPT TMEM234
Motif
Other DBs
NCBI-ProteinID: AEL73702
Position
3341004..3342122
Genome map
AA seq 372 aa AA seqDB search
MKWYDGLRHPGVLAALSAAILFGAGTPLAKQLLNTVSPWLLAGLLYLGSGIGLTLYRLIT
RPAAVSLPRNELLWFIGAILSGGIIAPVLLMVGLTGMPASGASLLLNAEGVFTALLAWFA
FKENVDRRIALGMVIIIAGAVVLSWPEEVLNWWPKEAQFAGLWPTLAILGACFAWGIDNN
LTRKVSLNDATWIAAVKGGVAGVVNLALAFALGATLPPLANLAGALLVGFLAYGVSLALF
VIGLRHLGTARTGAYFSIAPFLGAVLAVALGDTVTIPLLIAGLLMAIGIGLHLTEQHEHQ
HTHDEMIHEHEHIHDEHHQHRHDFPVDAGTAHKHRHQHLPMAHSHSHFPDSHHQHKHPRH
KHNQHKYHQHKH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtatgatggactacggcatccgggtgtattggcggcattgtctgctgcaata
ctgtttggtgccggtacccctctggcaaaacaattactgaataccgttagcccctggtta
ttggccggtttactttaccttggctcgggtattggcttaacactctaccgtttgatcact
cgcccggcggcggtgagcctgccccgtaatgaattattgtggtttattggtgccatcctc
tccggggggatcatcgcacccgtgctgctaatggtcggcctcacgggtatgcccgcctct
ggcgcatcactgttactcaatgctgaaggggtattcaccgcccttttagcctggtttgcc
ttcaaagagaatgttgaccgtcgtattgctctggggatggtgattatcatcgctggcgca
gttgtgcttagctggccagaagaagtacttaactggtggccaaaagaggctcaatttgcc
ggattatggccgacgctggccattttaggtgcctgctttgcctggggaattgataacaat
ctgacccgtaaagtctcgctgaacgatgcaacctggattgccgccgtcaaagggggcgtt
gccggagtggttaatctggcgctggccttcgccctcggagcaacattgccccctttggca
aatctcgctggcgcattgttggttggatttttggcttatggtgtcagtttggcgctattt
gtcattggattacgtcacctcggtactgcccgcaccggtgcctatttttctattgctccg
ttcttaggcgcagtgttggctgtcgccttaggtgacactgtcaccattccgttgctcatc
gcgggtcttttgatggcgatagggatcgggttacatcttacggagcagcatgaacatcaa
catacccatgatgaaatgatacatgagcatgaacatattcatgacgaacatcatcaacat
cgccatgactttccggtagacgcgggtaccgcgcataagcatcgtcatcagcacctaccg
atggcacactctcattcgcattttcctgattcacaccatcagcataaacatcctcgacat
aagcataatcaacataagtatcatcaacataagcactag

DBGET integrated database retrieval system